KEGG   Methanocaldococcus fervens: Mefer_1403Help
Entry
Mefer_1403        CDS       T00976                                 

Definition
(RefSeq) thymidine phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mfe  Methanocaldococcus fervens
Brite
Enzymes [BR:mfe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mefer_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1317878..1319389)
Genome map
AA seq 503 aa AA seqDB search
MLFLKVRVLDINLENLALINSEDLKNSQYFSQDRVVIEFKGKKVIGVLYSSTTLINRGEI
GLPQKLVKELGVKEGDVVTIRHAEKPKSLPYIRKKMDGNKLKKEEIFAIIDEMINGNLTN
IEISAFVTSLYINGMDMDEIEAMTIRMAETGEMVDWEGHIFDVHSIGGVPGNKYALLVVP
IVASAGLKIPKTSSRAITSAAGTADVVEVLTRVDLTVEEIKKVVKETNGCMVWGGALDLA
PADDITINVERPLGIDPEPLLLSSVMAKKLAMGVNKLLIDIPTGYGAKVKSIKEASSLAR
KFIELSDRLRIVTECAITYGGQPIGRAIGPALEAREALLALEDYKQAPTSLIEKSLSLAG
ILLEMGGVAPTGEGKYMAEDLLASGKAHDKFMEIIIAQGGKEVSSDEIELGKYKVDIHSP
IDGYVTRISNAGITRIAKEAGAPNDKKAGVYLNVKVGNKVEKGDVLYTIYSDSEERLKSA
AKLARILYPVKVEGMLLQKISRF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttctaaaagttagggttttagatatcaatttggaaaatttagctttaattaac
tctgaagatttgaaaaattcccagtatttttctcaagatagagtggttattgaatttaaa
ggaaaaaaggttattggggttttatattcatcaactacattgataaataggggagagata
ggactacctcaaaagttggttaaagaattgggagttaaggaaggggacgtagttacaata
aggcatgctgaaaaaccaaaatccctcccatacataagaaaaaagatggacggtaataaa
ttaaaaaaagaggagatttttgcaattatagatgagatgattaatggaaatctaacaaat
attgaaatatctgcctttgttacctccttatatataaatggaatggatatggatgaaatt
gaagcgatgaccattagaatggctgaaactggagagatggtcgattgggaaggacatata
tttgatgtgcattcaattggaggggttcctgggaataaatacgctttattagttgtgcca
atagttgcctctgcaggattgaagataccaaaaacatcatcgagagcaataacttcggcg
gcagggactgcagacgttgtagaggttttaacaagagtagatttaactgtcgaagagata
aaaaaggttgttaaagagacaaacggttgtatggtgtggggaggggctttagatttagct
ccagcagatgacataacaataaatgttgaaagacctcttggtatagaccctgagccatta
ctgttatcaagtgttatggcaaaaaaattggctatgggcgttaataagcttttaattgat
ataccaacaggatacggggcgaaagttaaatccataaaggaagcttcaagcttggcacga
aagtttattgaactgagtgatagattgaggatagttactgaatgtgctataacctacgga
ggtcagccaattggcagggcaattggtccagccttagaggcaagagaagctttattagct
ttagaagattataaacaagctccaacgagtttgatagagaaatctttatctttggctgga
attttattagagatgggtggagtagctcctactggagaaggaaaatacatggcagaggat
ttattggcaagtggaaaagcacatgataaatttatggaaattataatagctcagggggga
aaagaagttagctctgatgagattgaattaggaaaatataaggtggatatccattcacca
attgatgggtatgttacaagaatatcaaatgctggaattacaagaattgctaaagaggct
ggagctccaaatgataaaaaagctggtgtctatttaaatgtaaaagttggaaataaagtt
gaaaaaggagatgttttatacacaatatactctgattcagaagaaaggttaaaatcagct
gctaagttagcgagaatattatatccggtgaaagttgagggtatgttgcttcaaaaaatt
tcaagattctaa

DBGET integrated database retrieval system