KEGG   Methanocaldococcus fervens: Mefer_1494Help
Entry
Mefer_1494        CDS       T00976                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mfe  Methanocaldococcus fervens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mefer_1494
Enzymes [BR:mfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mefer_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1407431..1408162
Genome map
AA seq 243 aa AA seqDB search
MKVVITRPKERADVFSKLLKKEGFEPIIFPTLELIYNKDIKVNLDNYDWIVFTSPSGVIG
LYNIIEEAQREEVKNKKIAVIGEKTAKAFKEYFGREVDVMPKEYTAESLLEEIKKTAKSD
DKFLIPTTPSTRDVLKNNLNADLLFVYKSVEPENLKENIEKLKENIKDERFILTFTSGLT
AKNFFKYVDDEFAEIIKNNYIVAIGPITAKVIEEFGFKPLIPKIYTIEGILEVIKMIKEG
KND
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgtaataacaagacctaaagaaagggctgatgtgttttctaaattattgaaa
aaagaaggatttgagccgataatatttccaactttggaattaatatacaataaagatata
aaagttaatttagataattatgattggatagtttttacatctccgagtggagttattggc
ctatataatataattgaggaagcccagagggaagaggtaaaaaataaaaaaatcgctgtt
attggagaaaaaaccgcaaaagcttttaaagaatattttggtagagaagttgatgtaatg
ccaaaagaatacactgcagaatctcttttagaagagattaaaaaaaccgccaaaagtgat
gataaatttttaattcccacaacaccatcaacaagagatgttttaaaaaataacctaaat
gccgatttactgtttgtgtataaatcagttgagcctgaaaatctaaaggaaaatattgaa
aaattaaaagaaaatataaaggatgagaggtttatcttaacatttacaagtggattaaca
gctaaaaacttttttaaatacgttgatgatgaatttgccgagattataaaaaataattac
atagttgctataggaccgataacagcaaaagttattgaagaatttggatttaaaccatta
attccaaaaatatatacaattgaagggattttagaagttattaaaatgattaaagaggga
aagaatgattaa

DBGET integrated database retrieval system