KEGG   Methanocaldococcus fervens: Mefer_1530Help
Entry
Mefer_1530        CDS       T00976                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mfe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mfe01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfe00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mfe00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mfe00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1439846..1440505)
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYKESIGKRGLEIAKAAEKVSEESGVTIGVAPQFVDLRIIVENVNIPVYAQH
IDNINPGSHTGHILAEAIKDCGCKGSLINHSEKRMLLADIEAVINKCKDLGLETIVCTNN
INTSKAVATLNPDYIAVEPPELIGTGIPVSKANPEVVEGTVNAVKEINKDVKVLCGAGIS
KGEDVKAAMDLGAEGVLLASGVVKAKNVGEAIRELIKFI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgtaatcaactacaagacatacaaagagagtattggaaagagaggtttagaa
atagctaaagccgctgaaaaggttagtgaagaaagtggggtcacaattggagttgctcct
caatttgtagatttaaggataattgttgaaaacgttaatatcccagtttatgctcaacac
attgataatataaatcctggaagccatacagggcatatattggctgaggctattaaagat
tgcggttgtaagggaagtttaataaatcattcagagaagaggatgttattggcagacatt
gaggcggttataaataaatgtaaagatttaggattagaaacaattgtttgcacaaataat
ataaacacttccaaagcagttgcaaccttaaaccctgattatattgctgttgaacctcca
gaacttatagggacaggaattccagtatcaaaagcaaatccagaagttgttgaaggaacg
gttaatgctgttaaagagataaataaggatgttaaagtcctatgcggagctggaatatct
aagggagaggatgttaaggcagctatggatttaggtgctgagggtgttttattagcttct
ggagtagttaaggcgaagaatgttggagaggctataagagaattgataaaattcatctaa

DBGET integrated database retrieval system