KEGG   Methanocaldococcus fervens: Mefer_1530Help
Entry
Mefer_1530        CDS       T00976                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00010  Glycolysis / Gluconeogenesis
mfe00051  Fructose and mannose metabolism
mfe00562  Inositol phosphate metabolism
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01120  Microbial metabolism in diverse environments
mfe01130  Biosynthesis of antibiotics
mfe01200  Carbon metabolism
mfe01230  Biosynthesis of amino acids
Module
mfe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_1530
   00051 Fructose and mannose metabolism
    Mefer_1530
   00562 Inositol phosphate metabolism
    Mefer_1530
Enzymes [BR:mfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mefer_1530
Exosome [BR:mfe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mefer_1530
  Exosomal proteins of bladder cancer cells
   Mefer_1530
  Exosomal proteins of melanoma cells
   Mefer_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO ThiG FMN_dh His_biosynth IGPS Glu_synthase
Motif
Other DBs
NCBI-ProteinID: ACV25333
JGI: Mefer_1530
UniProt: C7P5F5
Position
complement(1439846..1440505)
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYKESIGKRGLEIAKAAEKVSEESGVTIGVAPQFVDLRIIVENVNIPVYAQH
IDNINPGSHTGHILAEAIKDCGCKGSLINHSEKRMLLADIEAVINKCKDLGLETIVCTNN
INTSKAVATLNPDYIAVEPPELIGTGIPVSKANPEVVEGTVNAVKEINKDVKVLCGAGIS
KGEDVKAAMDLGAEGVLLASGVVKAKNVGEAIRELIKFI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgtaatcaactacaagacatacaaagagagtattggaaagagaggtttagaa
atagctaaagccgctgaaaaggttagtgaagaaagtggggtcacaattggagttgctcct
caatttgtagatttaaggataattgttgaaaacgttaatatcccagtttatgctcaacac
attgataatataaatcctggaagccatacagggcatatattggctgaggctattaaagat
tgcggttgtaagggaagtttaataaatcattcagagaagaggatgttattggcagacatt
gaggcggttataaataaatgtaaagatttaggattagaaacaattgtttgcacaaataat
ataaacacttccaaagcagttgcaaccttaaaccctgattatattgctgttgaacctcca
gaacttatagggacaggaattccagtatcaaaagcaaatccagaagttgttgaaggaacg
gttaatgctgttaaagagataaataaggatgttaaagtcctatgcggagctggaatatct
aagggagaggatgttaaggcagctatggatttaggtgctgagggtgttttattagcttct
ggagtagttaaggcgaagaatgttggagaggctataagagaattgataaaattcatctaa

DBGET integrated database retrieval system