KEGG   Methanocaldococcus fervens: Mefer_1530Help
Entry
Mefer_1530        CDS       T00976                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mefer_1530
   01230 Biosynthesis of amino acids
    Mefer_1530
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_1530
   00051 Fructose and mannose metabolism
    Mefer_1530
   00562 Inositol phosphate metabolism
    Mefer_1530
Enzymes [BR:mfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mefer_1530
Exosome [BR:mfe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mefer_1530
  Exosomal proteins of bladder cancer cells
   Mefer_1530
  Exosomal proteins of melanoma cells
   Mefer_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1439846..1440505)
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYKESIGKRGLEIAKAAEKVSEESGVTIGVAPQFVDLRIIVENVNIPVYAQH
IDNINPGSHTGHILAEAIKDCGCKGSLINHSEKRMLLADIEAVINKCKDLGLETIVCTNN
INTSKAVATLNPDYIAVEPPELIGTGIPVSKANPEVVEGTVNAVKEINKDVKVLCGAGIS
KGEDVKAAMDLGAEGVLLASGVVKAKNVGEAIRELIKFI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgtaatcaactacaagacatacaaagagagtattggaaagagaggtttagaa
atagctaaagccgctgaaaaggttagtgaagaaagtggggtcacaattggagttgctcct
caatttgtagatttaaggataattgttgaaaacgttaatatcccagtttatgctcaacac
attgataatataaatcctggaagccatacagggcatatattggctgaggctattaaagat
tgcggttgtaagggaagtttaataaatcattcagagaagaggatgttattggcagacatt
gaggcggttataaataaatgtaaagatttaggattagaaacaattgtttgcacaaataat
ataaacacttccaaagcagttgcaaccttaaaccctgattatattgctgttgaacctcca
gaacttatagggacaggaattccagtatcaaaagcaaatccagaagttgttgaaggaacg
gttaatgctgttaaagagataaataaggatgttaaagtcctatgcggagctggaatatct
aagggagaggatgttaaggcagctatggatttaggtgctgagggtgttttattagcttct
ggagtagttaaggcgaagaatgttggagaggctataagagaattgataaaattcatctaa

DBGET integrated database retrieval system