KEGG   Mesoplasma florum L1: Mfl119Help
Entry
Mfl119            CDS       T00187                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mfl  Mesoplasma florum L1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mfl119
Enzymes [BR:mfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mfl119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(142941..144245)
Genome map
AA seq 434 aa AA seqDB search
MNYSFSEIIEKKKHSIELSAEEIKWLINSYVKNNVTDYQMAAFAMAVYFNGMTKAETLAL
TQSYVESGYVYDVSEVTGLKADKHSTGGVGDKTSLVYSPLVASYGVKVCKLSGRGLGVTG
GTIDKLESCKGWTSELSKEKFIKTINEVGMSITGQSDDIVPADKKMYALRDVTGTVDSIP
LIAASIMSKKLVIDSDSLILDVKVGAGAFMKNVDIAEKLANEMITIGHGYNRKVSILLTD
MQKPLGKAIGNAIEVKEAWDTLNNNGPEDLKEVVCTAAGLTLTDLGIFDKLEDAITDCYK
KLETGECAHYLEEFVEAQGGNFELIKNYDQNFTTKNKIEVFAEKDGYIISQDAETIGLLS
MDLGAGRKTKEDLIDFSAGIYLNKKTGDVVKTGDVVLTFYTNFDINNDWIERAKKSFIIS
TENEKQQNIIKIIR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaactacagttttagtgaaattatagaaaaaaagaaacattcaatagaattatcagct
gaagaaattaaatgattgataaacagttacgttaaaaataatgtaacagattatcaaatg
gctgcttttgctatggcggtttattttaatggaatgaccaaagcagaaactttagcatta
acccaatcttatgttgaatcaggatatgtttatgatgtcagtgaggttacaggtttaaaa
gctgataagcattcaactggcggagttggagacaaaacaagtttagtatatagtccgtta
gttgcaagttatggagtaaaggtttgtaaactttctggtagaggacttggagtaactggt
ggtactattgataaattagagtcatgtaaaggttgaacaagtgaattatctaaagaaaaa
ttcattaaaacaattaatgaagttggaatgagcatcacaggtcagtcagatgatattgtt
cctgctgataaaaaaatgtatgcactaagagatgttactggaactgttgattctattcct
ttaatcgctgcttctattatgagcaaaaaattagtaatcgatagtgacagtttaattcta
gatgttaaagttggagctggtgcatttatgaaaaatgtagacattgctgaaaaactagca
aacgaaatgattactattgggcacgggtataatagaaaagtttcaattcttcttactgac
atgcaaaaacctttaggaaaagctataggaaatgcaattgaagttaaggaagcttgagat
actttaaataacaatggtccagaagatttaaaagaagttgtttgtacagctgctggatta
actttaactgacttaggtatttttgataaattagaagatgctataactgattgttataaa
aaactagaaactggtgaatgtgcacattacttggaagaattcgttgaagctcagggcgga
aattttgagttaatcaaaaactatgatcaaaattttacaactaagaataaaattgaagta
ttcgctgaaaaagatggttacatcatttcacaagacgctgaaactataggtttactttca
atggatcttggagccggtagaaaaacaaaagaggatttaatagatttctctgctggaata
tatttaaataaaaaaactggtgatgttgtaaaaactggtgatgttgttttaactttctac
acaaactttgatattaacaatgattgaatagagagagctaaaaaaagttttattatttca
actgaaaatgaaaaacaacaaaatattataaagattattagataa

DBGET integrated database retrieval system