KEGG   Mesoplasma florum L1: Mfl174Help
Entry
Mfl174            CDS       T00187                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mfl  Mesoplasma florum L1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfl174
   01230 Biosynthesis of amino acids
    Mfl174
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfl174
   00030 Pentose phosphate pathway
    Mfl174
   00051 Fructose and mannose metabolism
    Mfl174
   00052 Galactose metabolism
    Mfl174
  Energy metabolism
   00680 Methane metabolism
    Mfl174
Enzymes [BR:mfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mfl174
Protein phosphatases and associated proteins [BR:mfl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mfl174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
202812..203783
Genome map
AA seq 323 aa AA seqDB search
MKRIGVLTSGGDAPGMNNAIAGVVKAAEAQGIEVYGVRDGYKGLINGWFEKLDSKFALEI
ISKGGTVLGSARLPEFKEESVRQKAVDQLKAHDIEALVVIGGDGSYMGAQRLTEMGINCI
GLPGTIDNDIVSSDYTIGFDTALNTVIESVEKVRDTMQSHNRAAVIEVMGNGCGDLVTYA
AIATQAEIFSPSESKLTVEQICEQAKKFAEANHRSLIILISEKQLDANELAKKVEEASGY
VTRATILGHVQRGGRPSGMDRYLAFTAAIYAVEKLIEGKGGLYIGLSENKLVARDIESTL
NMPKPDKTEFIEKIRLLNAKISK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattggagttttaacttcaggaggagatgcacctggaatgaataatgccatt
gctggagttgttaaagcagctgaagcacaaggtattgaagtttatggtgtaagagatggg
tataaaggtttaattaatggttgatttgaaaaattagattctaaatttgctttagaaatt
atttcaaaaggtgggactgttttaggttcagctagattaccagaattcaaagaagaaagt
gtaagacaaaaagctgttgatcaattaaaagcacatgacattgaagcattagttgttatt
ggtggagatggaagctacatgggagctcaaagattaactgaaatgggaataaactgtatt
ggtttaccaggaacaatagataatgatattgtttcaagtgattatacaattggatttgat
acagcattaaatacagttattgaatcagttgaaaaagtgcgtgatactatgcaatcacac
aatcgtgctgccgtaattgaagttatgggaaatggttgtggagatttagttacttatgca
gctattgcaactcaagcagaaatattttcaccaagtgaaagtaaattaactgttgaacaa
atatgtgaacaagctaaaaaatttgcagaagcaaaccacagaagtttaataatattaatt
agtgaaaaacaacttgatgctaatgaattagcaaaaaaagttgaagaagcaagtggttat
gtaactagagcaacaattttaggacatgttcaaagaggtgggcgcccatcaggtatggat
cgctatttagcttttacagcagcaatttatgcagttgaaaaattaattgaaggtaaaggt
ggactttacattggtctaagtgaaaacaaacttgttgcaagagatattgagtcaacattg
aatatgccaaagccagataagacagaatttatcgaaaaaataagattattgaacgcaaag
atatcaaaatag

DBGET integrated database retrieval system