KEGG   Mesoplasma florum L1: Mfl180Help
Entry
Mfl180            CDS       T00187                                 

Definition
1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
mfl  Mesoplasma florum L1
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mfl180
Enzymes [BR:mfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Mfl180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209217..210152
Genome map
AA seq 311 aa AA seqDB search
MIYTVTLNPALDHIIETDGFNIGETNYYKNEYVVIGGKGINVSIILNNLEAKVLSTGILG
SNNKNSFLEKFDENNLKNKFFINKGVTRTNLKIKNLSKFEETELNGLGSTVSLEIINELK
TFLNDNLKSGDILVAAGSIPAGVKNNIYEEIGNIANEKNALFILDTSKVNMLNGLKTKPY
LIKPNIEEICEILNLPFKEYTFEETCEMVKKLKSLGARNVLLSRGSKGSYFFSEKGEIFE
TGIAKGKLVNSVGSGDSMIAGFTYGLYKNLSIEECLQFGAAAGGATAFTEWLGLKEDILK
LKQEIKVNKIK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatatatacagtaacactaaatcctgctctagatcatattattgaaactgatggattt
aatattggtgaaactaattattacaaaaatgaatatgttgtaattggtggaaaaggtatt
aatgtttctattattttgaataatttagaagcaaaagttttatctactggtatcttggga
tcaaataataaaaattcgtttttagaaaaatttgatgaaaacaatttaaaaaacaaattt
tttataaataaaggtgtaacaagaacaaatttgaaaataaaaaacttatctaagtttgaa
gaaactgaattaaatggtttaggttcaacagtaagtttagagataataaatgaattaaaa
acctttttaaacgataacttaaaaagcggtgatattttagttgctgcaggaagtatacca
gctggtgttaaaaataatatttatgaagaaataggaaatattgcaaatgaaaagaatgct
ttatttattttagacacatcaaaggtaaacatgttaaatggtttaaaaacaaaaccttat
ttaataaaaccaaatatagaagaaatatgtgaaattttaaatttaccatttaaagaatat
acttttgaagaaacatgtgaaatggtaaaaaaattaaaatcattaggagctagaaatgtt
ttattaagcagaggaagcaaaggtagttatttcttttcagaaaaaggagaaatttttgaa
acaggaatagcaaaaggtaaattagttaattcagttggatctggagatagtatgattgct
ggattcacatatggattatataaaaatttatcaatagaagaatgccttcaatttggagct
gcagcaggtggggcaactgcctttaccgaatgattaggattaaaagaagacattttaaaa
ttaaaacaagaaattaaagttaacaaaataaaatag

DBGET integrated database retrieval system