KEGG   Mesoplasma florum L1: Mfl195Help
Entry
Mfl195            CDS       T00187                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mfl  Mesoplasma florum L1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mfl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221817..222710
Genome map
AA seq 297 aa AA seqDB search
MKNKGKVIIISGPSGVGKGSVNGELLTNKDLKLEYSVSMTTRAPREGEVNGVNYFFVSKE
EFANAIVNNELIEYANFVGNSYGTPRKYVEEKLNEGKNVILEIEVDGATQVLRNEENVLS
IFLMPPTLNELESRIKGRATESDDKIKARLDKALLEIPLKHNYDYVVENDSVENAVSKIT
DILIREKCTESNEESKFKELVKIVENIVDQKYTYFINNWEANVKLLAHNKEAKKEANDFD
ARGELIKILSSEVYRKTLAHGDFSKINDVEYVDFKIQKLMFKINFFSIKQRSDFSGD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaaggaaaagtaattattatatcaggaccaagtggtgtaggaaaagggagt
gttaatggtgaactacttactaacaaagatttaaaattagaatattcagtttctatgaca
acaagagcacctcgtgaaggtgaagttaatggtgttaattacttttttgtttcaaaagaa
gaatttgctaatgcaatagtaaacaatgagttaattgaatatgcaaattttgtaggtaac
tcatatggaacacctagaaaatatgtagaagaaaaacttaatgaaggtaaaaacgttatt
ttagaaattgaagtggatggtgccactcaagttttaagaaatgaagaaaatgttttatct
atatttttaatgccaccaacattaaatgaattagaatcacgaattaaaggaagagcaaca
gagtctgatgacaaaattaaagctcgtttagataaagctttattagaaatacctttaaaa
cataattatgattatgttgttgaaaatgattctgttgaaaatgcagtttctaaaattact
gatattttaattagagaaaaatgtactgaatctaatgaagaatctaaatttaaagaatta
gttaaaatcgttgaaaacattgttgatcaaaaatatacttattttataaataattgagaa
gcaaacgttaaattgttagcacataacaaagaagctaaaaaagaagcaaacgattttgat
gctagaggagaattgattaaaattttatcttctgaagtttatagaaaaactctagcacat
ggagatttttcaaaaattaatgatgtagagtatgtagattttaaaattcaaaaattaatg
ttcaaaattaactttttcagtataaaacaaagaagtgattttagtggagactaa

DBGET integrated database retrieval system