KEGG   Mesoplasma florum L1: Mfl322Help
Entry
Mfl322            CDS       T00187                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mfl  Mesoplasma florum L1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mfl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377296..379527
Genome map
AA seq 743 aa AA seqDB search
MNELLTFRGYVVKYGFSNDAGWGTGTFASEDNLKQHMSIKGSITSMDKKTLYEITGYFEE
HPRYGKSFNVQTYRKAPIHSTKEQIKFLAGPAFPGVGEKTAEIIINHLGDKAITQLVKNI
ELLNEIPGLNAIYIPIIKKGIEENIRQEGQERLRYIFFENNLKTSILDWMDNHFDQDNDI
IESIFSNSFLSFAKDKEIASFEELDKVAVHFGLELHSPERIAYWAWKLADDFLFASGDTY
TNKDYLSRSLMRKLKIQDTELLFEGILYAKEKGILKLTKNRIYTEESWREEQIIADNIIK
LNIPTKNANKEGISWEINQIEEEIAYENKIKDFKFDEKQREALELFANNKLSIITGGPGT
GKTTLIKGIVKLFNRMSGTEDYAIATPTGRAAARIRETYKKSYATTIHKLLEAKELNKFQ
ITQNNPLNQKLVILDECSMIDNKLFASFIQSCDRVRKVVLVGDANQLPSVGYGNTFADLL
ELDFLKTIKLDTVHRQKNGNGIVDLAYKVLNETLEISDLESMSNVEINFDYNNQNTMNKV
TEIVGQHWDDLEKRANHLQVICPMYGGELGIDEINAQIQNEFNENVKDKKKVYDRGDYRF
VVEDKIMFLKNDTDLDLANGDVGKIIKINYDAIGRLKDVLTEFNDKEILLQPKNFSDVKL
SYATSVHKTQGSEYNNVLLVIDSPKFNSGFINKTLIYTAVTRAKDKIVILGDSDLFFNAI
KITPPRRNTTLIETMLEKRETNG
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaattattaacttttagaggatatgtagttaaatatggtttttcaaatgatgct
ggttgaggaactggtacatttgctagtgaagataatttaaaacaacatatgagtattaaa
ggatcaataactagtatggataaaaaaactttatatgaaataactggatattttgaagaa
catcctcgttatggtaaaagttttaatgttcaaacttatcgaaaagcacctattcactca
actaaagaacaaattaaatttttagcaggtcctgcatttccaggtgtaggagaaaaaaca
gctgaaattataataaatcacttaggtgataaagcaattacacaattagttaaaaatatt
gaattattaaatgaaataccaggacttaatgctatttatatcccaattattaaaaaagga
atagaagagaatatcagacaagaaggtcaagaaagattaagatatatcttttttgaaaat
aatcttaaaacttcaatattagattgaatggataatcactttgatcaagataatgacatt
attgaaagcattttttcaaattcatttttatcttttgcaaaagataaagaaattgcttca
tttgaagaacttgataaagttgctgttcattttggattagaattacactcacctgaaaga
atagcttattgagcttgaaagttagctgatgattttttatttgcatctggagatacttat
acaaacaaagattatctttcaagaagtttaatgcgtaagttaaaaatacaagataccgaa
ttactttttgaaggtattttatatgctaaagaaaaaggtattttaaaattaactaaaaat
cgtatttatacagaagaatcttgaagagaagagcaaattatcgcagataatataataaag
cttaatatacccactaaaaatgccaataaagaaggtatttcatgagaaataaatcaaatt
gaagaagaaatagcttatgaaaataaaattaaagattttaaatttgatgaaaaacaaaga
gaagcattagaattatttgccaataataaattatctattattactggtggaccaggaact
ggtaaaacaacattgattaaaggaatagttaaattgtttaatcgtatgagtggtactgag
gactatgcaatagcaacaccaaccggaagagctgctgctagaattagagaaacatacaag
aaatcatatgcaacaacaatacacaaactattagaagcaaaagaacttaataagtttcaa
attacacaaaataatccattaaatcaaaaacttgtaattttagatgaatgctcaatgata
gataataaattatttgcaagttttatacaatcttgtgatcgagttagaaaagtagtttta
gttggtgatgctaatcaattaccaagtgtagggtatggaaatacatttgctgatttatta
gaactagattttttaaaaacaattaaactagatacagttcatagacaaaagaatggcaat
ggtattgttgatttagcttataaagtgttaaatgagacattagagataagtgatttagaa
tctatgagtaatgttgaaataaactttgattataataatcaaaacaccatgaacaaagtt
actgaaattgttggtcaacattgagatgatttagaaaaaagagctaatcatttacaagtt
atttgtccaatgtatggtggtgaattaggaattgatgaaatcaatgctcaaatccaaaat
gaatttaatgaaaatgttaaagataaaaagaaagtctatgatcgaggagattatcgattt
gtagttgaagataaaatcatgtttttaaaaaatgacactgatttagatttagctaatggt
gatgtaggtaaaataattaaaattaattatgatgctataggtagattaaaagatgtttta
actgaatttaatgataaagagatattattacaaccaaaaaactttagtgatgtaaaatta
tcttatgcaactagtgtgcataagactcaaggaagtgaatataataatgttttattagtt
atagatagtcctaaatttaattcaggctttattaataaaacattaatttacacagcagta
acaagagcaaaagataaaatagttattttaggtgatagtgatttattctttaatgcaatt
aaaataacaccacctagaagaaatacaacacttattgaaactatgctagaaaagagagaa
acaaatgggtaa

DBGET integrated database retrieval system