KEGG   Mesoplasma florum L1: Mfl340Help
Entry
Mfl340            CDS       T00187                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mfl  Mesoplasma florum L1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mfl340
Enzymes [BR:mfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mfl340
    3.5.1.-  
     Mfl340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396060..396551
Genome map
AA seq 163 aa AA seqDB search
MNKALIIVDYQYDFVDSNGKLYVHAAESKKTYIEYLIKIFNENNDLVVATKDMHPLDHYS
FAQWGPHCVVGTKGTDLYFDSSSIDKIIEKGKNKKTESYSAFFDEKGNSNFLDEYLRENN
IQELTIVGVALEVCVKATFEHAIELGYKTNLDLKGCAGFQDKK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagctttaataatagttgattatcagtatgattttgttgattcaaatggaaaa
ttgtatgtgcatgcagctgaaagtaaaaaaacttatatagaatatttaattaaaattttc
aatgaaaacaatgatttagttgttgctacaaaggatatgcacccacttgatcattattct
tttgctcaatgaggaccacattgtgttgttggaactaagggtactgatttatactttgat
tcttcttcaattgataagataattgaaaaaggcaaaaataaaaaaactgaaagttatagt
gccttttttgatgaaaaagggaattctaactttcttgacgaatatttaagagaaaataat
attcaagaattaactattgtgggagttgctttagaagtttgtgttaaagcaacttttgag
catgcaattgagttgggttataaaactaatttagatttaaaaggttgtgcaggatttcaa
gataaaaaataa

DBGET integrated database retrieval system