KEGG   Mesoplasma florum L1: Mfl421Help
Entry
Mfl421            CDS       T00187                                 

Definition
holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mfl  Mesoplasma florum L1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mfl421
Enzymes [BR:mfl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mfl421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(492940..493488)
Genome map
AA seq 182 aa AA seqDB search
MKDYLVCDINSKDDNYLYVEYQNKGEYFSYLTKDNFKNEKNIKLFIVDHNTEFENVEIVF
RSRDERNLFKELVKIKTVGLKTSFYLLNNFSFEEFIKMIEEYDIEKLAKLKGIGNYTAKL
IIEELQKHFFKNKITQKKEKIITSLVKLGFSYKTIMKNIANVDNLLSVDEITKIVMEQIS
YE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattatttagtttgtgatattaattcaaaggatgataattatttatatgttgag
tatcagaataaaggagaatacttttcttatttaacaaaagataattttaaaaatgaaaaa
aacattaaattgtttattgttgatcataatactgaatttgaaaatgttgaaatagttttc
agatcaagagatgaaagaaacctttttaaagaattggtgaaaattaaaacagtaggactt
aaaacttctttttatttattaaataatttttcatttgaagaatttataaaaatgattgaa
gaatatgatattgagaaattagctaaattaaaagggattggcaattatacagctaaacta
ataattgaagaattgcaaaagcattttttcaaaaacaaaataactcagaaaaaagaaaaa
ataataacatcacttgttaagctgggattttcttataaaacaataatgaaaaatattgct
aatgttgataatttactttcagtggatgaaataaccaaaatagttatggagcaaattagt
tatgagtaa

DBGET integrated database retrieval system