KEGG   Mesoplasma florum L1: Mfl421Help
Entry
Mfl421            CDS       T00187                                 

Definition
holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mfl  Mesoplasma florum L1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mfl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(492940..493488)
Genome map
AA seq 182 aa AA seqDB search
MKDYLVCDINSKDDNYLYVEYQNKGEYFSYLTKDNFKNEKNIKLFIVDHNTEFENVEIVF
RSRDERNLFKELVKIKTVGLKTSFYLLNNFSFEEFIKMIEEYDIEKLAKLKGIGNYTAKL
IIEELQKHFFKNKITQKKEKIITSLVKLGFSYKTIMKNIANVDNLLSVDEITKIVMEQIS
YE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattatttagtttgtgatattaattcaaaggatgataattatttatatgttgag
tatcagaataaaggagaatacttttcttatttaacaaaagataattttaaaaatgaaaaa
aacattaaattgtttattgttgatcataatactgaatttgaaaatgttgaaatagttttc
agatcaagagatgaaagaaacctttttaaagaattggtgaaaattaaaacagtaggactt
aaaacttctttttatttattaaataatttttcatttgaagaatttataaaaatgattgaa
gaatatgatattgagaaattagctaaattaaaagggattggcaattatacagctaaacta
ataattgaagaattgcaaaagcattttttcaaaaacaaaataactcagaaaaaagaaaaa
ataataacatcacttgttaagctgggattttcttataaaacaataatgaaaaatattgct
aatgttgataatttactttcagtggatgaaataaccaaaatagttatggagcaaattagt
tatgagtaa

DBGET integrated database retrieval system