KEGG   Mesoplasma florum L1: Mfl421Help
Entry
Mfl421            CDS       T00187                                 

Definition
(RefSeq) holliday junction DNA helicase ruvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mfl  Mesoplasma florum L1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mfl421
Enzymes [BR:mfl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mfl421
DNA repair and recombination proteins [BR:mfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mfl421
    RecFOR pathway proteins
     Mfl421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(492940..493488)
Genome map
AA seq 182 aa AA seqDB search
MKDYLVCDINSKDDNYLYVEYQNKGEYFSYLTKDNFKNEKNIKLFIVDHNTEFENVEIVF
RSRDERNLFKELVKIKTVGLKTSFYLLNNFSFEEFIKMIEEYDIEKLAKLKGIGNYTAKL
IIEELQKHFFKNKITQKKEKIITSLVKLGFSYKTIMKNIANVDNLLSVDEITKIVMEQIS
YE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattatttagtttgtgatattaattcaaaggatgataattatttatatgttgag
tatcagaataaaggagaatacttttcttatttaacaaaagataattttaaaaatgaaaaa
aacattaaattgtttattgttgatcataatactgaatttgaaaatgttgaaatagttttc
agatcaagagatgaaagaaacctttttaaagaattggtgaaaattaaaacagtaggactt
aaaacttctttttatttattaaataatttttcatttgaagaatttataaaaatgattgaa
gaatatgatattgagaaattagctaaattaaaagggattggcaattatacagctaaacta
ataattgaagaattgcaaaagcattttttcaaaaacaaaataactcagaaaaaagaaaaa
ataataacatcacttgttaagctgggattttcttataaaacaataatgaaaaatattgct
aatgttgataatttactttcagtggatgaaataaccaaaatagttatggagcaaattagt
tatgagtaa

DBGET integrated database retrieval system