KEGG   Mesoplasma florum L1: Mfl425Help
Entry
Mfl425            CDS       T00187                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mfl  Mesoplasma florum L1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfl425
Enzymes [BR:mfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Mfl425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498236..499594
Genome map
AA seq 452 aa AA seqDB search
MLKFPKNFHIGASMSAMQTEGKGITEIGDLTFDAYFKENPELFYHGVGPDLTSDITRHYK
DDIEKFKYIGLDSVRTGFSWARLFPDGINLNKEAVKFYHDYIDEYLKNDIEIIMTLFHFD
MPLWAHELGGWESREVIEKFISYCEFVFKEYGSKINYFVTFNEPLVPVFEGYVGKMHYPA
KDSPKEAVAQAYGIFLAHAKAVKLFKELKIDSKIGVVYNWNFTFPFSDSAEDKISAEIYD
AYVNRGPLNIMYNGNINPIIIKTLEEYNITPFHTSEEIEIIKQTEIDFLGVNYYFPCRVK
TNENVKNRWALDQMHIEIPADAKINPFRGWEIYPEGLYDISIAIKKELNNIPWYIAENGM
GVENEDRFRNENGQIDDDYRIEFLETHMSELKRGLDAGSNCFGYHIWAAIDCWSFRNAYK
NRYGLIEVDLKDQSRKFKKSAYWYKELIENKE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatttcctaaaaattttcacatcggtgcttcaatgagtgctatgcaaacagaa
ggaaaaggaattactgaaataggtgatttaacttttgatgcatatttcaaagaaaatccg
gaattgttttaccatggtgttgggccagatctgacaagtgatattacaagacactataaa
gatgatattgaaaaatttaaatacatcggattagattcagttagaacaggtttttcttga
gctagattatttccagatggtattaatctaaacaaagaagcagtaaagttctatcatgac
tatatcgatgagtatttaaaaaatgatattgaaattattatgactttatttcactttgac
atgcctttatgagcacatgaattaggtggttgagagagcagagaagttattgaaaaattt
ataagttattgtgaatttgtattcaaggaatatggatcaaaaataaattattttgttacc
ttcaatgaaccacttgttcctgtatttgaaggatatgtaggtaaaatgcactatcccgca
aaggatagtcccaaagaagctgtagctcaagcatatggaattttcctagctcatgctaaa
gcagtaaagttatttaaagaattaaaaattgattcaaaaataggagttgtttataactga
aactttacattcccattttcagattcagcagaagataaaatttcagctgaaatctatgat
gcttatgtaaatagaggaccattaaacattatgtataatggaaatattaacccaattatt
ataaaaaccttagaagaatataacataactccatttcacacaagcgaagaaattgaaata
attaaacaaactgaaattgattttttaggagttaattattatttcccttgtagagttaaa
acaaatgaaaatgtaaaaaatagatgagctttagatcaaatgcatattgaaattcctgca
gatgcaaaaattaatccttttagagggtgagaaatttatcctgaagggctatatgatata
tctatagcaattaaaaaagagttaaataacattccatgatacattgctgaaaatggtatg
ggtgttgaaaatgaagatagatttagaaatgaaaatggacaaatagatgatgattacaga
attgagtttttagaaactcatatgtctgaattaaaaagaggtttagatgctggatcaaat
tgttttggttaccacatttgagctgccattgactgctgaagctttagaaatgcttataaa
aatagatatggtttaattgaagttgatttaaaagaccaatctagaaagtttaaaaaatca
gcttactgatataaagaactaatagaaaataaggagtaa

DBGET integrated database retrieval system