KEGG   Mesoplasma florum L1: Mfl497Help
Entry
Mfl497            CDS       T00187                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mfl  Mesoplasma florum L1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mfl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mfl00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mfl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mfl00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(583524..584462)
Genome map
AA seq 312 aa AA seqDB search
MILNIDLGGNSAKCALIENFEIKSKFFVETPKFEIIENLKKMIDIYFKENGYKWENIEAI
SFSVPGAYDKKTEIIVFAGNLNWWNYPLLKEARRIFNFEKIFILNDANAATYGEWKKGQD
GIPESMMLFTLGTGVGHGLILNKQIWEGTKKGYASEGGHGGCFADEELLCSCGVYGCLEA
KSSATGIERELNKTDNKNYIESKFGKEFKTIKIIDIVELFNNEDPVIINIFKECLMPLSK
AIGYLQTVLDVDKVIIGGGPSNLGERISEIIFENLKKYTLKSFYEDMVIEIAKLGNDAGI
WGAYYWAVENIK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatactaaatattgatttaggtggaaattcagctaaatgcgcacttattgaaaacttc
gaaataaaaagtaagttttttgttgaaacaccaaaatttgaaataattgaaaatttaaag
aaaatgatagatatttattttaaagaaaatggctataaatgagaaaatattgaagcaata
tctttttctgtgcctggcgcatacgataaaaaaactgaaattattgtttttgcaggtaat
ttaaattgatgaaattatcctcttttaaaagaagcaagaagaatattcaattttgaaaaa
atatttattttaaatgatgccaatgctgcaacttatggtgaatgaaaaaaaggtcaagat
ggtataccagaatctatgatgctgttcactttaggaactggagttggtcatggtttaatt
ttaaataaacaaatttgagaaggaactaaaaaaggatacgcaagtgaaggtggccatggt
ggttgtttcgctgatgaagaattactttgctcatgtggtgtttatggttgtttagaagca
aaaagtagtgctacaggtatagagcgtgaacttaataaaactgataacaagaattacatt
gaatcaaaatttggaaaagaatttaagacaataaaaattattgatattgttgaattgttt
aataacgaagatcctgttattataaacattttcaaagagtgcttaatgcctttatctaaa
gctattggatatttacaaactgttttagacgttgataaagtaataattggaggtggccct
tcaaatttaggcgaaagaatatctgaaataattttcgaaaatttaaaaaaatatacttta
aaatcattttatgaagatatggttatagaaatagctaaacttggtaatgacgcaggaatt
tgaggagcttattactgagctgtagaaaatattaaataa

DBGET integrated database retrieval system