KEGG   Mesoplasma florum L1: Mfl497Help
Entry
Mfl497            CDS       T00187                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mfl  Mesoplasma florum L1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfl497
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfl497
   00052 Galactose metabolism
    Mfl497
   00500 Starch and sucrose metabolism
    Mfl497
   00520 Amino sugar and nucleotide sugar metabolism
    Mfl497
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mfl497
   00524 Butirosin and neomycin biosynthesis
    Mfl497
Enzymes [BR:mfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mfl497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(583524..584462)
Genome map
AA seq 312 aa AA seqDB search
MILNIDLGGNSAKCALIENFEIKSKFFVETPKFEIIENLKKMIDIYFKENGYKWENIEAI
SFSVPGAYDKKTEIIVFAGNLNWWNYPLLKEARRIFNFEKIFILNDANAATYGEWKKGQD
GIPESMMLFTLGTGVGHGLILNKQIWEGTKKGYASEGGHGGCFADEELLCSCGVYGCLEA
KSSATGIERELNKTDNKNYIESKFGKEFKTIKIIDIVELFNNEDPVIINIFKECLMPLSK
AIGYLQTVLDVDKVIIGGGPSNLGERISEIIFENLKKYTLKSFYEDMVIEIAKLGNDAGI
WGAYYWAVENIK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatactaaatattgatttaggtggaaattcagctaaatgcgcacttattgaaaacttc
gaaataaaaagtaagttttttgttgaaacaccaaaatttgaaataattgaaaatttaaag
aaaatgatagatatttattttaaagaaaatggctataaatgagaaaatattgaagcaata
tctttttctgtgcctggcgcatacgataaaaaaactgaaattattgtttttgcaggtaat
ttaaattgatgaaattatcctcttttaaaagaagcaagaagaatattcaattttgaaaaa
atatttattttaaatgatgccaatgctgcaacttatggtgaatgaaaaaaaggtcaagat
ggtataccagaatctatgatgctgttcactttaggaactggagttggtcatggtttaatt
ttaaataaacaaatttgagaaggaactaaaaaaggatacgcaagtgaaggtggccatggt
ggttgtttcgctgatgaagaattactttgctcatgtggtgtttatggttgtttagaagca
aaaagtagtgctacaggtatagagcgtgaacttaataaaactgataacaagaattacatt
gaatcaaaatttggaaaagaatttaagacaataaaaattattgatattgttgaattgttt
aataacgaagatcctgttattataaacattttcaaagagtgcttaatgcctttatctaaa
gctattggatatttacaaactgttttagacgttgataaagtaataattggaggtggccct
tcaaatttaggcgaaagaatatctgaaataattttcgaaaatttaaaaaaatatacttta
aaatcattttatgaagatatggttatagaaatagctaaacttggtaatgacgcaggaatt
tgaggagcttattactgagctgtagaaaatattaaataa

DBGET integrated database retrieval system