KEGG   Mesoplasma florum L1: Mfl504Help
Entry
Mfl504            CDS       T00187                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfl  Mesoplasma florum L1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfl504 (tpiA)
   01230 Biosynthesis of amino acids
    Mfl504 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfl504 (tpiA)
   00051 Fructose and mannose metabolism
    Mfl504 (tpiA)
   00562 Inositol phosphate metabolism
    Mfl504 (tpiA)
Enzymes [BR:mfl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mfl504 (tpiA)
Exosome [BR:mfl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mfl504 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mfl504 (tpiA)
  Exosomal proteins of melanoma cells
   Mfl504 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(591600..592427)
Genome map
AA seq 275 aa AA seqDB search
MLLSFLFHWFSYCYIIKNVQKNKRRNIMRQKVIFGNWKMNGTNAELVTFLKKVDKAAKKS
DVVAGLGLPFTLLSKGIEKAKNVKVAAQNVHFAEKGAFTGEVSISMLQEVGVQYVIIGHS
ERREMFAETDETVNKKATALLAAGITPIICCGETLETKEAKKTVTFVNAQIKKAYKGISA
EDALKTIIAYEPIWAIGTGKTATSEDAEKVCEAIRKNLTKIYDEKTAQQITIQYGGSVNP
SNIAELMSQPNIDGALVGGASLKADDFIALINYKK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttgttatcttttttatttcattgattttcttattgttatataattaaaaatgtacaa
aaaaacaagaggagaaatatcatgagacaaaaagtaattttcggaaattgaaaaatgaac
ggaactaatgctgaacttgttactttcttaaaaaaagttgacaaggctgctaaaaaatca
gatgtagttgcaggattaggattaccatttacattattatcaaaaggaattgaaaaagca
aaaaatgttaaagttgctgcacaaaatgttcactttgctgaaaaaggagcatttactgga
gaagtttcaatttcaatgttacaagaagtaggagtacaatacgttattattggtcactca
gaaagaagagaaatgtttgctgaaactgatgaaacagtaaacaaaaaagctactgcatta
ttagctgcaggaatcacaccaattatttgttgtggtgaaactttagaaactaaagaagct
aaaaaaactgttacatttgtaaacgcacaaattaaaaaagcatataaaggaattagtgca
gaggatgcattaaaaacaattattgcttatgaaccaatctgagctattggaacaggtaaa
actgcaacaagtgaagatgctgaaaaagtgtgtgaagctattcgtaaaaatttaacaaaa
atttatgacgaaaaaactgcacaacaaattactattcaatatggtggaagtgttaaccca
tcaaacattgctgaattaatgtcacaaccaaacattgatggagcacttgttggtggagct
tcattaaaagctgatgattttattgcattaatcaattacaaaaaataa

DBGET integrated database retrieval system