KEGG   Mesoplasma florum L1: Mfl581Help
Entry
Mfl581            CDS       T00187                                 

Definition
(RefSeq) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mfl  Mesoplasma florum L1
Pathway
mfl03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Mfl581
Enzymes [BR:mfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Mfl581
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Mfl581
DNA repair and recombination proteins [BR:mfl03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Mfl581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Ribosomal_S13 Glyoxalase_2 FbpA Auto_anti-p27 DZR
Motif
Other DBs
NCBI-GeneID: 2897792
NCBI-ProteinID: YP_053823
UniProt: Q6F0N4
Position
complement(676319..677146)
Genome map
AA seq 275 aa AA seqDB search
MPELPEVRTVAVFLNKRIVNTTILKAECFFEKMIWRNEVKDFYKSVLNQKILKVSNYGKY
LMFELSNQIIISHLRMEGKWSISKKEIDIYNANHLRLQFELSNGEYLKYYDSRKFGTIEI
WDKKNYKQKSGMDKLGPEPLNSQPSFEYLKEKAIKSNSLIKAFILDQSVLCGIGNIYANE
ILFAAGINPERITKTLTDEELKKIIMFSNAILEKAISLKGTSIHSYKSGDGETGQFQHEL
KVHLRKDEKCFVCGTKILKKQVAGRGTYFCAKCQH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactaccagaggttagaacggttgctgtttttttaaataaaagaatagtcaat
acaacaattttaaaagcagaatgtttttttgaaaaaatgatttgaagaaatgaagttaaa
gacttttataaaagtgttttaaatcaaaaaatattgaaagtttcaaattatggaaaatat
ttaatgtttgaactttcaaatcaaattattattagtcatttgagaatggaaggcaaatga
agcatttcaaaaaaagaaatagatatttataatgcaaaccatttaagattgcaatttgag
ctatcaaatggtgaatatttaaaatattatgattctagaaaatttggaacaattgaaatt
tgagataaaaaaaattataaacaaaaaagtggaatggataaattaggtccagagccatta
aatagtcaaccttcttttgaatatctaaaagaaaaagcaattaaatctaattccttaatt
aaggcttttatattagatcaaagtgttctttgtggaattggtaatatatatgcaaacgaa
attttatttgctgcaggtattaatccagaaagaataacaaaaacattaacagatgaagaa
cttaaaaaaattatcatgttttctaatgcaatattagaaaaagctatcagtttaaagggg
acttcaattcatagttataaatctggggatggcgaaactggtcaattccaacatgaatta
aaagtgcacttaagaaaagacgaaaaatgctttgtttgcggaacaaagatattaaaaaaa
caagttgcaggtcgcggaacatacttttgtgcaaaatgtcaacactag

DBGET integrated database retrieval system