KEGG   Mesoplasma florum L1: Mfl677Help
Entry
Mfl677            CDS       T00187                                 

Definition
(RefSeq) recombination protein
  KO
K06187  recombination protein RecR
Organism
mfl  Mesoplasma florum L1
Pathway
mfl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mfl677
DNA repair and recombination proteins [BR:mfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Mfl677
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mfl677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 Toprim RecR PHF5 Rsd_AlgQ S8_pro-domain RNA_pol_Rpb2_7
Motif
Other DBs
NCBI-GeneID: 2897937
NCBI-ProteinID: YP_053917
UniProt: Q6F0E0
Position
complement(787057..787647)
Genome map
AA seq 196 aa AA seqDB search
MNNELFEEIINNINKNNGLTKKTSERLVNNLIIDKFALDNFSKQLNFIKDNFSICPICNY
YQIKNECLICSDETRNQNVICVVASQLDVNNIEKINKYKGLYHVLGSEINLNKKRSPSEI
NFESLLSRIEKNTELILALNATFEGELTTNYIYQLTKNMNINITRIAKGIPMGGSLDYMD
ETTLESAFKNRKKYEV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaattgtttgaagaaattataaataatataaataaaaacaatggacttact
aaaaagacaagtgagagattggtaaataatttgattatagataaatttgctttagacaat
ttttctaaacaattaaattttataaaagacaatttttctatttgccctatttgcaattac
tatcaaattaaaaacgaatgtttgatttgctcagatgaaactagaaaccaaaatgttatt
tgtgttgttgcaagtcaacttgatgttaataatattgaaaaaattaataaatataaaggt
ctttatcatgtacttggatcagaaataaatctaaacaaaaaaagatcaccttcagaaata
aattttgaaagcttattatctagaattgaaaaaaacactgaattgatattagcattaaac
gcaacttttgaaggagagctaacaacaaattatatttatcaattaactaaaaacatgaat
ataaacattacgagaatagcaaaaggtataccaatgggtggtagccttgattatatggat
gaaacaacacttgaaagcgcatttaaaaatagaaagaaatacgaggtttaa

DBGET integrated database retrieval system