KEGG   Mycoplasma fermentans M64: MfeM64YM_0318Help
Entry
MfeM64YM_0318     CDS       T01402                                 

Gene name
ruvA-3
Definition
holliday junction ATP-dependent DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mfm  Mycoplasma fermentans M64
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mfm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344090..344692
Genome map
AA seq 200 aa AA seqDB search
MVLYRIGEIVYKNNQNLIFESQGVGYSIIFPDHARVEAKQKMKLYLYEIRNDYTWSLYGF
KDFKERLLFMDLINLNGIGPRVAFNILNQGWEKVASLIALGKVDHLIEIPYINPRIARIV
VGELQDKWAKITNTQDAQKQVKNSNLLSEAKETLKMLGFKAAQIDSALTKVELNQDVESM
IEEAIKFISQSGAQNEQLNA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggttttatatcgaatcggagaaattgtttataaaaataatcaaaatttaatttttgaa
agtcaaggagtaggttattcaataatctttccagatcatgctagagttgaagctaaacaa
aaaatgaagttgtatctatatgaaataagaaacgattacacttgatctttatatggattt
aaagatttcaaagaacgcttattatttatggacttaattaatttaaatggaattggacca
agagttgcttttaacatccttaaccaaggatgagaaaaagttgcatctttaattgcttta
ggtaaagtagatcacctaattgaaattccttatattaatccaagaattgctcgaattgta
gttggcgaattacaagacaaatgagctaaaataactaatactcaagatgcacaaaaacaa
gttaaaaattcaaatttattaagtgaagctaaagaaacattaaaaatgttaggctttaaa
gcagctcaaattgattcagcattaactaaagttgaattaaatcaagatgttgaatcaatg
attgaagaagcaattaaatttatttctcaaagtggtgctcaaaatgaacagcttaatgct
tag

DBGET integrated database retrieval system