KEGG   Mycoplasma fermentans M64: MfeM64YM_0504Help
Entry
MfeM64YM_0504     CDS       T01402                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mfm  Mycoplasma fermentans M64
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MfeM64YM_0504 (pfkA)
   01230 Biosynthesis of amino acids
    MfeM64YM_0504 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MfeM64YM_0504 (pfkA)
   00030 Pentose phosphate pathway
    MfeM64YM_0504 (pfkA)
   00051 Fructose and mannose metabolism
    MfeM64YM_0504 (pfkA)
   00052 Galactose metabolism
    MfeM64YM_0504 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MfeM64YM_0504 (pfkA)
Enzymes [BR:mfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MfeM64YM_0504 (pfkA)
Protein phosphatases and associated proteins [BR:mfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MfeM64YM_0504 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548375..549367
Genome map
AA seq 330 aa AA seqDB search
MKKIKRIAILTSGGDAPGMNSAIRAAAKMARSRGIETFLVYEGYKGLVDDNIVPSTKIDL
DFFNSRGGTCIYSARYPQFKDPEIREIAIKNLNKRKIDALIVIGGDGSYAGAQLLHEKGI
KTIGLPGTIDNDIASSDFTIGYDTALNTVVRCIDQIRDTAASHKRIMIIEVMGNNCGDLA
LHTGLATGAEVIATSEYRLDEKEIVKTCVELTTNAKPVRRNITIVVSEKLYNIKQLAKDI
EKATGWETRPNVLGHIQRGGNPSAQERILASLFGIKAVECLLEGKSGVAIGIIDNDIVAS
PISEALSMINKSKAKVRNKAIKFNELNRLD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaagagaattgctattctaacttcaggtggcgatgctcctggaatgaat
agtgcaattagagcagcagctaaaatggctcgtagtcgtggaattgaaacatttttagta
tatgaaggttacaaaggattagttgatgataatattgtgccttcaacaaaaattgattta
gatttctttaacagtcgtggaggcacttgtatttattcagcaaggtatcctcaatttaaa
gatccagaaattcgtgaaattgctattaaaaatttaaacaaacgtaaaattgatgctttg
atagttattggtggtgatggttcttatgcaggagcacaattattacatgaaaaaggaatt
aaaactattggacttccagggacaattgataatgatatagcttcaagtgattttactatt
ggctatgatacagctttaaatacagttgttagatgtattgaccaaattagagatacagca
gcaagtcataaaagaattatgattattgaagttatgggtaataactgtggtgacttagca
ttacacacaggacttgcaacaggggcagaagttattgcaacaagtgaataccgtcttgat
gaaaaagaaatagttaaaacttgtgttgaattaactacaaatgctaaacctgttagaaga
aatattacaatagttgttagtgaaaaattatataacattaaacaactagctaaagacatt
gaaaaagcaacaggatgagaaactagacctaatgttttaggacacattcaacgtggtggt
aatccttcagctcaagaaagaattctagcttcactttttggaattaaagctgttgaatgt
ttacttgaaggtaaaagcggtgtggctattggaattattgataatgatattgttgcttca
ccaatctcagaagcattaagtatgattaataaatctaaagctaaagttagaaataaagca
attaaatttaatgaattaaaccgtttagattaa

DBGET integrated database retrieval system