KEGG   Mycoplasma fermentans M64: MfeM64YM_0645Help
Entry
MfeM64YM_0645     CDS       T01402                                 

Gene name
gtaB
Definition
utp-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfm  Mycoplasma fermentans M64
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MfeM64YM_0645 (gtaB)
   00052 Galactose metabolism
    MfeM64YM_0645 (gtaB)
   00500 Starch and sucrose metabolism
    MfeM64YM_0645 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MfeM64YM_0645 (gtaB)
Enzymes [BR:mfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MfeM64YM_0645 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(691440..692348)
Genome map
AA seq 302 aa AA seqDB search
MTTKENEIKKIKKLIIPAAGWGTRFLPMTKIIHKELVPILDTPVIDRLVNEALDSGIEEI
LIVLSERKKDLLKFFSVDQDLQTELIIKGKKDILEKVKRTNRSSCITRVIQKEQFGLGHA
LASCKEYIDNEPFAIILGDDLIKSKTPAIKQLIEFYNKTGANVIGVQSVAKEYIHKYGIV
NPINLKDKDKKYFEINGAVEKPKADKAPSNKAILGRYVFNPEILDILSRIEYDGKNEIQA
VDAFDELMKKYKQKIYAYEFEGIRYDLGSMEGFVKANIDYALEEPEIADKIKSFINEKVK
EF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaagagaatgaaattaaaaaaattaaaaaattgattattcctgcagctggc
tgaggaacaagatttttacctatgacaaaaattattcataaagaattagtgcctattctt
gatacacctgttattgatagattagttaatgaagcacttgattcaggtattgaggaaatt
ttaattgttttaagtgaaaggaaaaaggatttattaaaatttttctcagttgatcaagat
ttacaaacagaattaattatcaaaggtaaaaaagatattttagaaaaagttaaaagaaca
aatcgctcttcatgtattactagagtaattcaaaaggaacaatttggtttaggtcatgca
cttgcaagttgtaaagaatatattgacaatgagccgtttgctattattttaggtgatgac
ttaattaaatcaaaaactcctgctattaagcaattaatcgagttttataataaaactgga
gcaaatgttattggtgtacaatcagtagcaaaagaatatattcataaatatggaattgtt
aatccaataaacttgaaagataaagataagaaatattttgaaattaatggtgcagttgaa
aaacctaaggctgataaagcaccatcaaataaagctatacttggacgttatgtctttaat
ccagaaattttagatatcttatctagaattgaatatgatggcaaaaatgaaattcaagca
gttgatgcatttgatgaattaatgaaaaaatataaacaaaaaatttatgcctatgaattt
gaaggcatcagatatgatcttggatcaatggaaggctttgttaaagcaaacattgattat
gctttagaagaacctgaaattgcagacaagattaaaagttttattaatgaaaaagttaaa
gaattttaa

DBGET integrated database retrieval system