KEGG   Mycoplasma fermentans M64: MfeM64YM_0725Help
Entry
MfeM64YM_0725     CDS       T01402                                 

Gene name
adhT
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mfm  Mycoplasma fermentans M64
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:mfm01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfm00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mfm00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mfm00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:mfm00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(773634..774701)
Genome map
AA seq 355 aa AA seqDB search
MAKTTMKAFVVEKPKQWSVKEVPIPKPGPKQVLIRMETSGVCHTDLHAANYDWLVEPKYP
LIPGHEGIGIVEKLGPGCTRLKKGDRVCLAWLHDACGLCEWCLQGEETLCPKQNMSAYTF
DGSFAEYAIGHEDYVGIVPEGLDLITGAPVVCAGVTTYKAIKRAKARPGYWMVVIGVGGL
GQLAIQYAKAMGYRPIGIDLTDEKCELALKSGAEFAFNSKKDPNFIQKLIEKTGGGAHAV
INTSVATIAGEQGMEMLRRGGRQVLVGLPSKDKLGKDNIGVSVFWTVLFEKELAGSIVGT
RLDLQESLQYAAEGKVKSEVTKVIKLEEVSEVFEKLQKGEFLGRAVIDFGYRGKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacaactatgaaagcttttgttgttgaaaaaccaaaacaatgaagtgttaag
gaagttccaattccaaaaccagggcctaaacaagttcttattagaatggaaacttcaggg
gtatgccacacagacttacacgctgcaaactatgactgattggtagaacctaaatatcca
ttaattccaggacacgaaggtatcggtattgttgaaaaacttggtccaggatgtacacgt
cttaaaaaaggtgacagagtttgtctagcatgattacatgatgcttgtggattatgtgaa
tgatgtttacaaggtgaagaaacactttgtcctaaacaaaacatgtcagcttacacattt
gatggatcatttgctgaatatgcaattggacacgaagattatgtaggaattgttccagaa
ggattagatttaattactggagcacctgtagtatgtgctggtgttacaacctataaggca
attaaaagagctaaagctcgtccaggttactgaatggttgttatcggtgttggtggactt
ggccaattagcaattcaatatgctaaagcaatgggatatagacctattggtatcgactta
acagatgaaaaatgcgaattagctttaaaatcaggagcagaatttgcattcaactctaag
aaagatccaaactttattcaaaaacttattgaaaagactggtggtggagctcacgctgta
attaacacatcagttgctacaattgctggtgaacaaggcatggaaatgcttcgtcgtgga
ggacgtcaagtattagtaggccttccatcaaaagacaaacttggtaaagacaacattggc
gtttcagtattctgaacagtattgttcgaaaaagaattagctggatcaatcgttggtaca
agacttgatttacaagaatcacttcaatatgctgcagaaggaaaagttaaatcagaagtt
acaaaagttattaaactagaagaagtttcagaagtatttgaaaaacttcaaaaaggtgaa
ttcttaggacgtgctgttattgactttggttacagaggaaagaaataa

DBGET integrated database retrieval system