KEGG   Mycoplasma fermentans M64: MfeM64YM_0725Help
Entry
MfeM64YM_0725     CDS       T01402                                 

Gene name
adhT
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mfm  Mycoplasma fermentans M64
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MfeM64YM_0725 (adhT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MfeM64YM_0725 (adhT)
  Lipid metabolism
   00071 Fatty acid degradation
    MfeM64YM_0725 (adhT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MfeM64YM_0725 (adhT)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MfeM64YM_0725 (adhT)
   00626 Naphthalene degradation
    MfeM64YM_0725 (adhT)
Enzymes [BR:mfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MfeM64YM_0725 (adhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(773634..774701)
Genome map
AA seq 355 aa AA seqDB search
MAKTTMKAFVVEKPKQWSVKEVPIPKPGPKQVLIRMETSGVCHTDLHAANYDWLVEPKYP
LIPGHEGIGIVEKLGPGCTRLKKGDRVCLAWLHDACGLCEWCLQGEETLCPKQNMSAYTF
DGSFAEYAIGHEDYVGIVPEGLDLITGAPVVCAGVTTYKAIKRAKARPGYWMVVIGVGGL
GQLAIQYAKAMGYRPIGIDLTDEKCELALKSGAEFAFNSKKDPNFIQKLIEKTGGGAHAV
INTSVATIAGEQGMEMLRRGGRQVLVGLPSKDKLGKDNIGVSVFWTVLFEKELAGSIVGT
RLDLQESLQYAAEGKVKSEVTKVIKLEEVSEVFEKLQKGEFLGRAVIDFGYRGKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacaactatgaaagcttttgttgttgaaaaaccaaaacaatgaagtgttaag
gaagttccaattccaaaaccagggcctaaacaagttcttattagaatggaaacttcaggg
gtatgccacacagacttacacgctgcaaactatgactgattggtagaacctaaatatcca
ttaattccaggacacgaaggtatcggtattgttgaaaaacttggtccaggatgtacacgt
cttaaaaaaggtgacagagtttgtctagcatgattacatgatgcttgtggattatgtgaa
tgatgtttacaaggtgaagaaacactttgtcctaaacaaaacatgtcagcttacacattt
gatggatcatttgctgaatatgcaattggacacgaagattatgtaggaattgttccagaa
ggattagatttaattactggagcacctgtagtatgtgctggtgttacaacctataaggca
attaaaagagctaaagctcgtccaggttactgaatggttgttatcggtgttggtggactt
ggccaattagcaattcaatatgctaaagcaatgggatatagacctattggtatcgactta
acagatgaaaaatgcgaattagctttaaaatcaggagcagaatttgcattcaactctaag
aaagatccaaactttattcaaaaacttattgaaaagactggtggtggagctcacgctgta
attaacacatcagttgctacaattgctggtgaacaaggcatggaaatgcttcgtcgtgga
ggacgtcaagtattagtaggccttccatcaaaagacaaacttggtaaagacaacattggc
gtttcagtattctgaacagtattgttcgaaaaagaattagctggatcaatcgttggtaca
agacttgatttacaagaatcacttcaatatgctgcagaaggaaaagttaaatcagaagtt
acaaaagttattaaactagaagaagtttcagaagtatttgaaaaacttcaaaaaggtgaa
ttcttaggacgtgctgttattgactttggttacagaggaaagaaataa

DBGET integrated database retrieval system