KEGG   Mycoplasma fermentans M64: MfeM64YM_0973Help
Entry
MfeM64YM_0973     CDS       T01402                                 

Gene name
recR
Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
mfm  Mycoplasma fermentans M64
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MfeM64YM_0973 (recR)
DNA repair and recombination proteins [BR:mfm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MfeM64YM_0973 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1012638..1013228
Genome map
AA seq 196 aa AA seqDB search
MKIETIEKLNQVLTTIPGISKKQADKMSNFFLKQDQEYIDNLVKSINDLKTNISYCSICN
FLKEGGKCLVCDDKSRYNFLMIVENAATLRKIDDMNFYNGYYYVLPYLFNLKNNKEIKNY
DYKELINYIQHKKFDEVIIVLSPSLEGEMTTGHLLKLINSQFKIKVTRAAIGMPMGSNLE
YLDTFTIKQSIENRNK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaaacaattgaaaaacttaatcaagttttaacaacaattccaggaattagt
aaaaagcaagcagacaaaatgtcaaactttttcttaaaacaagatcaagaatatattgac
aatttagttaagtcaattaatgatcttaaaaccaacatttcatattgttctatttgtaac
tttttaaaagaaggtggcaaatgtttagtatgtgatgataagagcagatacaacttttta
atgatagttgaaaatgctgcaactttaagaaaaattgatgacatgaatttttacaatggc
tactactatgttttgccttatttgtttaatttaaagaataataaggaaattaaaaactat
gattacaaagaattaataaactatattcaacataaaaaatttgatgaagtaatcatagtt
ttgagcccttctttagaaggcgaaatgacaacaggtcatttattaaaattgattaatagc
caatttaaaattaaagtaacaagagcagctattggcatgcctatgggttcaaatttagaa
tatcttgatactttcacaatcaaacaatctattgaaaatagaaacaaataa

DBGET integrated database retrieval system