KEGG   Mycoplasma fermentans M64: MfeM64YM_1012Help
Entry
MfeM64YM_1012     CDS       T01402                                 

Gene name
glck
Definition
(RefSeq) glucokinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mfm  Mycoplasma fermentans M64
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MfeM64YM_1012 (glck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MfeM64YM_1012 (glck)
   00052 Galactose metabolism
    MfeM64YM_1012 (glck)
   00500 Starch and sucrose metabolism
    MfeM64YM_1012 (glck)
   00520 Amino sugar and nucleotide sugar metabolism
    MfeM64YM_1012 (glck)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MfeM64YM_1012 (glck)
   00524 Butirosin and neomycin biosynthesis
    MfeM64YM_1012 (glck)
Enzymes [BR:mfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MfeM64YM_1012 (glck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1053570..1054451
Genome map
AA seq 293 aa AA seqDB search
MKIATADIGGTNTRFALFKKNKFWSKVKFETNKNNYRETLNHIAHLCNLHKIECLALCIP
GPADYDKGIVLNTPNLPGWVNKNIKKYLFKHTNLKEIITENDANVMALANHKYYKQKKSD
VTQFFTVSTGLGAGLIINDQIYVGKNHLAQEIARAPLGTDEDDSFHLLPYSVELYASGTG
IELRYNKLTGEKLNAKKIFALYPNNENAKKIINEGIDSLARTISTSLAFLNPSLVVFGGS
VSEHNNWFIEKAIEKAKTYTIKSQYQNVKFAFDPYTDFSAVMGLYCLAKDKFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaacagcagatattggcggaacaaatacaagattcgctttatttaaaaaa
aataaattttgatctaaagttaaatttgaaactaataaaaataattatcgtgaaacttta
aatcatattgctcatttatgcaatttgcataaaatagaatgcttggctttatgtattcca
ggaccagccgactatgacaaaggaatagttttaaatacacctaatttacctggttgagtt
aacaaaaacattaaaaaatatttatttaagcatactaatctaaaagaaataattactgaa
aacgatgctaatgttatggctttggcaaatcacaaatattacaaacaaaagaaaagtgat
gtaactcaatttttcacagtatcaacaggtttaggtgctggtcttattattaatgatcaa
atatatgttggtaaaaatcacttagctcaagaaatcgcgagagcacctttaggtactgat
gaagatgactcatttcatttacttccttattcagtggaattgtatgcttcaggaacaggc
attgaattaagatataacaaattaacaggagaaaaattaaacgctaaaaaaatttttgct
ttatatccaaataatgaaaatgcaaaaaaaataataaatgaaggtatagattctttagct
agaactatctcaacttctttagcttttttaaatccaagtcttgttgtttttggcggtagt
gttagtgaacataataattggtttatagaaaaagctattgaaaaagctaaaacatataca
attaaatctcaatatcaaaatgtaaaatttgcttttgatccttatacagatttcagcgct
gtaatgggtttatattgtttagcaaaagataaatttaaataa

DBGET integrated database retrieval system