KEGG   Mycoplasma fermentans M64: MfeM64YM_1012Help
Entry
MfeM64YM_1012     CDS       T01402                                 

Gene name
glck
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mfm  Mycoplasma fermentans M64
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MfeM64YM_1012 (glck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MfeM64YM_1012 (glck)
   00052 Galactose metabolism
    MfeM64YM_1012 (glck)
   00500 Starch and sucrose metabolism
    MfeM64YM_1012 (glck)
   00520 Amino sugar and nucleotide sugar metabolism
    MfeM64YM_1012 (glck)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MfeM64YM_1012 (glck)
   00524 Butirosin and neomycin biosynthesis
    MfeM64YM_1012 (glck)
Enzymes [BR:mfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MfeM64YM_1012 (glck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1053570..1054451
Genome map
AA seq 293 aa AA seqDB search
MKIATADIGGTNTRFALFKKNKFWSKVKFETNKNNYRETLNHIAHLCNLHKIECLALCIP
GPADYDKGIVLNTPNLPGWVNKNIKKYLFKHTNLKEIITENDANVMALANHKYYKQKKSD
VTQFFTVSTGLGAGLIINDQIYVGKNHLAQEIARAPLGTDEDDSFHLLPYSVELYASGTG
IELRYNKLTGEKLNAKKIFALYPNNENAKKIINEGIDSLARTISTSLAFLNPSLVVFGGS
VSEHNNWFIEKAIEKAKTYTIKSQYQNVKFAFDPYTDFSAVMGLYCLAKDKFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaacagcagatattggcggaacaaatacaagattcgctttatttaaaaaa
aataaattttgatctaaagttaaatttgaaactaataaaaataattatcgtgaaacttta
aatcatattgctcatttatgcaatttgcataaaatagaatgcttggctttatgtattcca
ggaccagccgactatgacaaaggaatagttttaaatacacctaatttacctggttgagtt
aacaaaaacattaaaaaatatttatttaagcatactaatctaaaagaaataattactgaa
aacgatgctaatgttatggctttggcaaatcacaaatattacaaacaaaagaaaagtgat
gtaactcaatttttcacagtatcaacaggtttaggtgctggtcttattattaatgatcaa
atatatgttggtaaaaatcacttagctcaagaaatcgcgagagcacctttaggtactgat
gaagatgactcatttcatttacttccttattcagtggaattgtatgcttcaggaacaggc
attgaattaagatataacaaattaacaggagaaaaattaaacgctaaaaaaatttttgct
ttatatccaaataatgaaaatgcaaaaaaaataataaatgaaggtatagattctttagct
agaactatctcaacttctttagcttttttaaatccaagtcttgttgtttttggcggtagt
gttagtgaacataataattggtttatagaaaaagctattgaaaaagctaaaacatataca
attaaatctcaatatcaaaatgtaaaatttgcttttgatccttatacagatttcagcgct
gtaatgggtttatattgtttagcaaaagataaatttaaataa

DBGET integrated database retrieval system