KEGG   Methanoregula formicica: Metfor_0693Help
Entry
Metfor_0693       CDS       T02392                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mfo  Methanoregula formicica
Pathway
mfo00340  Histidine metabolism
mfo01100  Metabolic pathways
mfo01110  Biosynthesis of secondary metabolites
mfo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Metfor_0693
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Metfor_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGB01753
UniProt: L0HEL5
Position
680578..681822
Genome map
AA seq 414 aa AA seqDB search
MWKAVGIDAWLAARKTSLEDARGTVTGIIGRVKNEGDAALIDLAKKYCTLEHVAVTDEER
ESAYDEVDAQVVEALIEAHARIERFHERQRPRDLWFEEMEPGVVLGMKSTGLNRVGLYVP
GGRAAYPSSALMCAVPAKVAGVKEICACSPPPIKPLTLVALDIAGVTEIYQAGGAQAVAA
MALGTESIRPVQKIVGPGNIYVTLAKMMLREHAEIDFPAGPSEIGIIADSTAHPKVVAAD
VLAQAEHDPNAACILITTDPTLPAKVGKEIEKMVAEAPRKEIIVEALKNSGYTVVKDIDE
AIAASDVVAPEHLSIQVADPLMVVTKVQNAGAIFVGRYSAVACGDYAVGTNHCLPTAGYS
KMYSGLDVAHFCKTASVEIIDRDGLEAIGDIVETIAEAEGLYAHSQSVKVRRAL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggcagtcgggatcgatgcatggctcgcagcacggaagacgagccttgaggat
gcacgcgggaccgtcaccgggatcatcgggcgggtgaaaaacgagggggatgccgcactc
attgacctggcaaagaaatactgcacgctggagcatgttgcggttaccgatgaggagcgg
gaatccgcatacgacgaagttgatgcacaggttgtcgaggccctgatcgaagcccacgcc
cggatcgaacgcttccacgaacgccagcggccccgtgatctctggttcgaggagatggag
ccgggtgttgtcctcgggatgaagtctaccggcctgaaccgggtcggcctctacgtgccc
ggcggcagggcagcctacccgtcgtctgcactgatgtgcgctgtcccggcgaaggttgcc
ggggtaaaagagatctgtgcctgctcgccaccgcccatcaagcccctgacccttgttgcg
cttgacattgcaggtgtcaccgagatctaccaggcgggcggtgcgcaggcagttgcggcc
atggcgcttggcacggaatccatccgtccggtccagaagattgtcggccccggcaatatc
tatgttaccctcgcaaagatgatgctccgcgaacatgccgagatcgacttcccggcaggc
ccgagtgagatcgggatcatcgcggacagcacggcccacccgaaagttgttgcagcagac
gtccttgcacaggccgagcacgacccgaacgcagcctgcatcctcatcacaacggatccc
accctcccggcaaaggtcggaaaggagatcgagaagatggtggccgaggctccccggaaa
gagatcattgtcgaggccctgaagaactccgggtatactgtagtgaaggatatcgacgag
gcaatcgcggcatccgatgtcgtggcacccgagcatctctccatccaggttgccgatccg
ctcatggtagtgacaaaagtacagaatgccggcgccatcttcgttggccggtactcggcg
gttgcctgtggcgactatgcggtcggcaccaaccactgccttcccactgcagggtactcg
aagatgtactcggggctggatgttgcacacttctgcaagacggcatcggtggagatcatc
gaccgcgacgggcttgaagcgattggtgatattgttgagacgattgccgaagccgagggg
ctgtatgcccactcccagtccgtaaaggtccggcgggcattgtaa

DBGET integrated database retrieval system