KEGG   Methanoregula formicica: Metfor_0693Help
Entry
Metfor_0693       CDS       T02392                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mfo  Methanoregula formicica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metfor_0693
  Amino acid metabolism
   00340 Histidine metabolism
    Metfor_0693
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Metfor_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680578..681822
Genome map
AA seq 414 aa AA seqDB search
MWKAVGIDAWLAARKTSLEDARGTVTGIIGRVKNEGDAALIDLAKKYCTLEHVAVTDEER
ESAYDEVDAQVVEALIEAHARIERFHERQRPRDLWFEEMEPGVVLGMKSTGLNRVGLYVP
GGRAAYPSSALMCAVPAKVAGVKEICACSPPPIKPLTLVALDIAGVTEIYQAGGAQAVAA
MALGTESIRPVQKIVGPGNIYVTLAKMMLREHAEIDFPAGPSEIGIIADSTAHPKVVAAD
VLAQAEHDPNAACILITTDPTLPAKVGKEIEKMVAEAPRKEIIVEALKNSGYTVVKDIDE
AIAASDVVAPEHLSIQVADPLMVVTKVQNAGAIFVGRYSAVACGDYAVGTNHCLPTAGYS
KMYSGLDVAHFCKTASVEIIDRDGLEAIGDIVETIAEAEGLYAHSQSVKVRRAL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggcagtcgggatcgatgcatggctcgcagcacggaagacgagccttgaggat
gcacgcgggaccgtcaccgggatcatcgggcgggtgaaaaacgagggggatgccgcactc
attgacctggcaaagaaatactgcacgctggagcatgttgcggttaccgatgaggagcgg
gaatccgcatacgacgaagttgatgcacaggttgtcgaggccctgatcgaagcccacgcc
cggatcgaacgcttccacgaacgccagcggccccgtgatctctggttcgaggagatggag
ccgggtgttgtcctcgggatgaagtctaccggcctgaaccgggtcggcctctacgtgccc
ggcggcagggcagcctacccgtcgtctgcactgatgtgcgctgtcccggcgaaggttgcc
ggggtaaaagagatctgtgcctgctcgccaccgcccatcaagcccctgacccttgttgcg
cttgacattgcaggtgtcaccgagatctaccaggcgggcggtgcgcaggcagttgcggcc
atggcgcttggcacggaatccatccgtccggtccagaagattgtcggccccggcaatatc
tatgttaccctcgcaaagatgatgctccgcgaacatgccgagatcgacttcccggcaggc
ccgagtgagatcgggatcatcgcggacagcacggcccacccgaaagttgttgcagcagac
gtccttgcacaggccgagcacgacccgaacgcagcctgcatcctcatcacaacggatccc
accctcccggcaaaggtcggaaaggagatcgagaagatggtggccgaggctccccggaaa
gagatcattgtcgaggccctgaagaactccgggtatactgtagtgaaggatatcgacgag
gcaatcgcggcatccgatgtcgtggcacccgagcatctctccatccaggttgccgatccg
ctcatggtagtgacaaaagtacagaatgccggcgccatcttcgttggccggtactcggcg
gttgcctgtggcgactatgcggtcggcaccaaccactgccttcccactgcagggtactcg
aagatgtactcggggctggatgttgcacacttctgcaagacggcatcggtggagatcatc
gaccgcgacgggcttgaagcgattggtgatattgttgagacgattgccgaagccgagggg
ctgtatgcccactcccagtccgtaaaggtccggcgggcattgtaa

DBGET integrated database retrieval system