KEGG   Methanoregula formicica: Metfor_0883Help
Entry
Metfor_0883       CDS       T02392                                 

Definition
magnesium chelatase ATPase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mfo  Methanoregula formicica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metfor_0883
Enzymes [BR:mfo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Metfor_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(871113..873062)
Genome map
AA seq 649 aa AA seqDB search
MHHFDDIYPFSAIVGQEQMKKALLLNAINPRIGGVLIKGEKGTAKSTAARALARLLPDKQ
VVDGCTCGCDPSDSKRLCPECWERVSTLTVKTTRMKVIELPISATEDKVVGSLDIEYALK
KGERKFEPGVLAKAHRNILYVDEVNLLNDHIVDVLLDAAAMGMNIIEREGVSYVHPSEFI
LIGTMNPEEGELRPQLLDRFGLCVDIVGIDDADTRVEVVRRRQAYEQAPGTFIESWQEEE
QGLRERIVRAKELLPEVSVSEEMLAMIAQICIDMAVDGHRADIVMLKTAATIAAFNGRKE
VTEEDVREAAELVLSHRMRRQPFSDQQMDKEKVEQSIEKSQQEKKQPEQQQQNPENQKPK
ENTTPDGSTTTQFAEGQPFKVNQKPLATPRRIDSFKRDGSGRRSVTESRDGKYVRSRIPE
TIGPDIALDATIRAAAPHQKDRKGPLAVKIESSDLREKVRERKMGNTVLFVVDASGSMGA
QQRMTAVKGAILSLLIDAYQKRDRVGLVVFRGKTAEVLLPPTSSVELARKYMQQLPVGGK
TPLAHGLSKAFEVLQREKMINRHTIPRLILISDGKANVSRGSGSPLDDANEVAARIKDAG
ISSLVIDSEKGYIAFGLAQTLSQEMGAKYLKLEDLQADQIADVVKGIGM
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatttcgacgatatatacccgttctccgccatcgtcggccaggagcagatgaag
aaggcgctgctcctgaatgcaatcaacccccgtatcgggggagtcctgatcaagggagag
aaggggaccgcaaaatccacggcagcccgggcccttgcccgcctcctcccggataagcag
gtggttgatgggtgtacttgcgggtgtgatccatcagattccaaaagactttgtcctgaa
tgctgggaacgcgtatccacactcacggtgaagaccacccgcatgaaagttatcgaactt
ccgatcagcgccaccgaagataaagtggtcggcagtctggatatcgagtatgccctcaag
aaaggtgagcggaagttcgagcccggcgtactggcgaaagcacaccggaacatcctgtac
gtggatgaagtgaacctcctcaacgatcatatcgtggacgtcctcctcgacgctgctgca
atggggatgaacattatcgagcgcgaaggagtctcctatgtccatccctcggaattcatc
ctgatcggaacgatgaacccggaagagggcgaactccggccccagctcctcgaccgtttc
gggctctgcgtggatatcgtcgggattgatgatgccgatacgcgggttgaggtcgtgcgc
cggagacaggcgtacgaacaggctcctggcacattcatcgaatcatggcaggaggaagaa
cagggtctgagagagcgcattgtacgagcaaaagaactgctgccggaggtctctgtatcc
gaagagatgctcgccatgatcgcacagatctgcatcgacatggcagtcgacggccaccgg
gcagatatcgtgatgctgaagaccgccgcaaccatcgcggcattcaacggcagaaaagaa
gtaacggaagaggatgtccgcgaggcagccgaactcgtcctctcccaccgcatgcgcagg
cagccattctccgaccagcagatggacaaggagaaggtggagcagtccatagagaagtcc
caacaggaaaagaagcagcccgaacagcagcagcagaaccccgagaaccagaagccaaag
gagaacacgacaccggacggatcgacgacaacacagttcgccgaagggcagccgttcaaa
gtcaaccagaagccgctggccacgccgcggcggatcgattcattcaagcgggatgggagc
ggcaggaggagcgtgaccgagtcccgggatgggaaatatgtccggagccggattcccgag
accataggaccggacattgcgctggacgccacgatccgggcggcagccccccaccagaaa
gacaggaaagggccgcttgcagttaaaatcgaatcctcggatttgagggaaaaagtccgc
gaacggaagatggggaacaccgtcctcttcgtcgtcgatgccagtgggagcatgggcgcc
cagcagcggatgactgcggtcaagggtgccatcctctcgctcctcatcgatgcctaccag
aaacgcgaccgcgtcggccttgtggtattccggggaaagaccgctgaagtcctccttccc
ccgacatccagcgtggagctggcccggaagtatatgcagcagctcccggtcgggggaaag
accccgctcgcccacgggctctcgaaagccttcgaagtgctccagcgcgagaagatgatc
aaccggcacaccattccccggcttatcctcatctctgacgggaaggcgaacgtgagccgg
ggatccggttcgccgctggacgatgcaaacgaggttgctgcccgcataaaggatgcaggg
atctcctcgctcgtcatcgattcggagaaggggtatatcgccttcgggctcgcgcagacc
ctgtcgcaggagatgggggcaaaatacctgaaactggaagacctgcaggcagaccagatc
gccgatgtggtgaaaggaatagggatgtaa

DBGET integrated database retrieval system