KEGG   Methanoregula formicica: Metfor_0996Help
Entry
Metfor_0996       CDS       T02392                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mfo  Methanoregula formicica
Brite
Enzymes [BR:mfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Metfor_0996
Transfer RNA biogenesis [BR:mfo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Metfor_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
978244..979830
Genome map
AA seq 528 aa AA seqDB search
MDEEPALREIISRLLTLPEGAFNDAIVVAAKIETCRKYSLPAVPKNSAILAAARPEEYET
LRRILLVKPSRTLSGVAPVAVMTSPYPCPHGKCLPCPGGPEHPFHSPQSYTGEEPAAKRA
REHEYDPFRQIRARLEQFEVLGHRVDKVELIVMGGTMTARPVGYQEEFVSRCIEAMNVYP
ETTSASQYLPVATVESANETSAIRCVAMTFETRPDWCRREHIDRMLDLGVTKVELGVQHT
DDVILAYNRRGCTVADTVAANTLLRDAGLKVGFHMMPNLPSSSIEADRQMFATLFDDPRF
RPDFLKIYPTLVTPGSEIEDLWKRGGYSPYDEEKLIDLIAYGKSLIPEYTRLQRIQRDIP
AKLIVAGSPHSNFRQLAQNRLKALGKRCRCIRCREIGRLPSLAGMEIRVLEYKACGGKEH
FISAVSDDSLIGFSRLRFPSQVYRPELEGAAVMRELHVYGSVVPLGKDAESEEWQHRNFG
KMLLGRAEEIALAAGYYNLAIMSGIGVRPYYRRQGYERRGPYMIKGLS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggaacctgctctccgggagatcatctcccgcctcctcacccttcctgaaggt
gcgttcaacgatgccatcgttgttgcggctaagatagagacctgcaggaagtattccctg
ccggcagtgccgaagaactccgcgatccttgctgctgcaaggccggaagagtacgagacc
ctgcgcaggatcctgcttgtcaagccgtctcgcaccctgtccggtgttgccccggttgct
gtgatgacctccccgtatccctgcccccatggcaagtgccttccctgcccgggcgggccg
gagcacccgttccattccccgcagagttataccggagaggaaccggcggcaaagcgggca
cgtgagcacgagtatgacccgttccggcagatccgggcccggctggaacagttcgaggtg
ctgggccaccgcgtggataaggtggaactgatcgtgatgggcgggacaatgaccgcccgc
cctgtcggataccaggaagaattcgtctcccgatgcatcgaggcaatgaacgtctacccg
gaaaccacgtctgcatcacagtacctgccggtggccacggtcgagtcggctaatgagaca
tccgcgatccggtgcgttgccatgacctttgagacccggccggactggtgccggcgggag
cacatcgaccggatgcttgaccttggcgtaacaaaagtggaactcggtgtccagcacaca
gacgatgtgatccttgcctataaccggcggggctgcacggttgcagacacggtagcggcg
aatacgctcctccgtgacgccgggctgaaggtcgggttccacatgatgcccaatctccct
tcctccagcatcgaagcggaccggcagatgttcgcgacactctttgacgatccccgcttc
aggccagacttcctgaagatctacccgacgctcgtcacacctggatccgagattgaggat
ctctggaaacggggcggatattctccgtatgatgaggaaaagcttatcgatctcatagcg
tacgggaagtcccttatcccggaatacacccggctccagcggatccagcgggatatcccg
gccaagctgatcgttgccggctccccgcactccaacttccggcaactggctcagaaccgg
ttgaaggcgctcgggaagcggtgccggtgcatccgctgccgggagattgggcgtctcccc
tcccttgcagggatggaaatccgcgtcttggaatacaaggcctgtggaggaaaggaacac
ttcatctcggcggtttcggatgattccctcatcggcttctcccggctccggttcccgtcg
caggtctaccgccccgaactcgaaggggcggcggtcatgcgcgagctgcacgtgtacggc
agcgtcgtccccttgggaaaggatgccgagtctgaggagtggcagcaccggaacttcggg
aagatgctccttggacgggccgaggagattgcattggccgccggttactacaatcttgcc
atcatgagtggcatcggtgtccggccgtattaccgcaggcagggatatgaacgcagaggg
ccttatatgatcaaggggttgtcatga

DBGET integrated database retrieval system