KEGG   Methanoregula formicica: Metfor_1142Help
Entry
Metfor_1142       CDS       T02392                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mfo  Methanoregula formicica
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metfor_1142
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metfor_1142
Enzymes [BR:mfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Metfor_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1104314..1105210)
Genome map
AA seq 298 aa AA seqDB search
MRHIISIGDFDRDGINRLLDHAGQIDRKKYDAQALDGKILAVLFFEPSTRTRLSFESAIA
RLGGTSLTVGSVEACSIAKGETLADTIRVVSGYADAIVIRHPKEGAARLASEFSTVPVIN
AGDGAGQHPSQTLLDLYTIRQSMPIDGINIALIGDLRYGRTAHSLASALSLYNARLHTLC
PRGLELPETLSARLEEQGMEIIAHENITDIIPEVDALYVTRVQRERFPDSASYFNVASSY
RITPELLADAKKHLIVLHPLPRVDEIDPRVDEMPHAKYFEQSRNGVPVRMAMLMQVMQ
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccacatcatatcgatcggggactttgaccgtgacgggatcaaccgcctgctggac
catgcagggcagatcgacaggaagaagtacgatgcacaggcccttgacggtaaaatcctt
gccgtcctcttctttgagcccagcacgcggacacggctctcgtttgaatctgccatcgcc
cgcctcggcggcacatccctgacggtgggaagtgtcgaggcctgctccattgcaaaaggc
gaaacccttgccgacaccatccgtgttgtgagcgggtatgcagacgcaattgttatccgg
cacccgaaagaaggcgcagcgcgcctggcctctgaattctccaccgtcccggtcatcaac
gcaggagacggtgccggccagcacccgtcccagaccctccttgacttgtacaccatccgc
cagtccatgcccatcgacggcatcaacatcgcgctcatcggggacctgcgctacggcagg
accgcccattcgcttgcctccgccctctcgctttacaatgcacggctgcacacgctctgc
cctcggggactcgaacttcccgagacgctctccgcgcgactggaggagcaggggatggag
atcatcgcccatgagaatatcactgatatcatccccgaagtggatgccctctacgtgacg
cgggtccagcgcgagcggttccccgattcggcatcctacttcaatgttgcatcaagctac
cgcatcactcctgagctcctcgctgatgcaaagaagcacctgatcgtcctccaccccctc
ccaagggttgacgagatcgatccccgggtcgacgagatgccgcacgcaaagtatttcgaa
cagtcacgaaacggcgtcccggtacggatggcgatgctgatgcaggtgatgcaatga

DBGET integrated database retrieval system