KEGG   Methanoregula formicica: Metfor_1334Help
Entry
Metfor_1334       CDS       T02392                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mfo  Methanoregula formicica
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Metfor_1334
Enzymes [BR:mfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Metfor_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291122..1291658
Genome map
AA seq 178 aa AA seqDB search
MPVREFERIGKRLFAEHLVGGNFGNISVRKGDEGFYIKRTGDYLDEVHELVFVPFVGVVP
KNASSEYRVHSDVYRNSSHQAIVHAHPQAAIAASLVRDAVLAEDSEGKMFCPKIPVVEGA
PGTQELANNVVSALKTTKLVIVRGHGTFAAGKNLDEAFQLTSLADHSCRVIALKHFFQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtacgcgaattcgagcggatcggaaaacgactctttgccgagcacctcgttggc
ggcaacttcggtaacatcagtgtccgtaaaggagatgagggcttttatatcaagcggacc
ggtgattatctggatgaagtccatgaactggtcttcgtcccgtttgtcggggttgtccca
aaaaatgcatccagcgagtaccgtgtccacagtgatgtataccggaactcttcccaccag
gccatcgttcatgctcatccccaggcagcaatagccgcatcactggtgagggatgcggtc
ctggcggaagacagtgaaggaaagatgttctgcccgaaaattcccgttgttgagggagca
ccgggcacgcaggaacttgccaataacgtagtctcagctctcaaaacaacaaaactggtc
attgttcgggggcatgggacatttgcggcgggaaagaatcttgatgaagcgtttcagttg
acatcgcttgccgaccactcgtgccgggtaatcgcgttaaaacacttttttcagtaa

DBGET integrated database retrieval system