KEGG   Methanoregula formicicum: Metfor_1518Help
Entry
Metfor_1518       CDS       T02392                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mfo  Methanoregula formicicum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Metfor_1518
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Metfor_1518
Enzymes [BR:mfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Metfor_1518
Two-component system [BR:mfo02022]
 CheA family
  CheA-CheYBV
   Metfor_1518
Bacterial motility proteins [BR:mfo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Metfor_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1468851..1469891
Genome map
AA seq 346 aa AA seqDB search
MVKLLIVDDSVFMRTVIRDMVTKDPTIEVVGTASNGVDALEKIQNLEPDLVTLDIEMPKM
NGIQVLEELKRQRKRPKILMLSTLTSEGAEMTTRAIRLGADDFMLKPKDIPHVRVIGDEL
VTKLKHLVTLPALPAVHRASPTTGPASHVVLIGSSAGGPPMLDTLLAAIPQDIPAGIVVT
QHMPIGFTAALAERFNRIASLPVKETENGDIVENGKILLSKAGVHTIISNDMDANKTRLG
KIIHSNTAPLHGVRPAVDKTFESAAKVYGKNIVSVILSGMGNDAGAGAQAIKEAGGTSLL
CDEKDCLVYGMARSAIQKNAVDKVLPLAKLAPEIERLVHQMEAANV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagctgctgatcgttgatgattccgtgtttatgcgcacggtcatccgggatatg
gtgacaaaggatccgaccattgaggtagtgggaacagcctcgaacggtgtcgacgccctg
gagaagatccagaatcttgagccggatcttgtgacgcttgatattgagatgcccaaaatg
aacggcatccaggtactcgaggaacttaaaaggcaacgcaagcgtccgaaaatcctgatg
ctcagcacactcacgtcagagggagctgaaatgacaacccgtgctatccgcctcggggca
gacgatttcatgctcaaacccaaggacattcctcatgtccgggtgattggcgacgaactg
gtcacgaaactgaaacatctcgttacccttccagcgttacctgcggtgcacagggcctcc
cccactaccggacctgcatcacatgttgtcctgattggatcatctgcaggaggacccccg
atgctcgacaccctgctcgctgccatccctcaggacattcctgctggcatcgttgtcacc
cagcacatgcctatcgggtttactgcagcgcttgcagaacggttcaaccggatcgcttcc
ctgccggtgaaggagacagagaacggggatattgttgagaatggcaagatcctgctttca
aaggccggggtgcacaccattattagtaacgatatggacgcgaacaagacccggctggga
aagatcatccattcgaacacggcccccctccatggcgtgaggcctgctgttgacaagacc
ttcgaatccgcggcgaaggtttatggaaagaatatcgtgtcggtaatcctgagcgggatg
gggaacgatgccggcgccggcgcacaggccatcaaggaggccgggggaaccagcctcctt
tgtgatgagaaagactgtctggtgtatggtatggcacgatctgcaatccagaaaaatgct
gtcgataaggtactgccgctcgcaaaactcgctcccgagatagaacggctggtacatcag
atggaggctgccaatgtctga

DBGET integrated database retrieval system