KEGG   Methanoregula formicicum: Metfor_1821Help
Entry
Metfor_1821       CDS       T02392                                 

Definition
acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mfo  Methanoregula formicicum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mfo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mfo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1774763..1775941
Genome map
AA seq 392 aa AA seqDB search
MHVSRICSDLVKIRSENPPGTTAEVIEYIRGFLDGIGIRSEVFCAGQGMDNLVAIQKDAT
LMLCGHVDVVPAPGDNWSRPPFSGDIAEGCVWGRGATDMKGGCAAILSACETLADAGKDM
PATLAFVCDEETGGENGTRFLLAKKALPPCDCIIAEPTPSLHPSIGQKGLCRMEIAFSGI
PAHGSLYPAVGRSAIMEAVPFLEWVKTLYNRDYPVDASLQEIINRSAGVVAKEFRIDGVS
DVLQRLTFNPGTIHGGEKSNVVAERCTLELEIRVPWGCSIPETIAEIRAHAGNAVVTPQE
AFVPTITDPSSRIVTVTCNAVQHAWNKPSFPFVQWAASDARHLRSAGFRVIEYGPGEIES
LHAVNERVTITSLEKAVEIYGDVMQQYAGEQA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcagccgcatctgttcggatctcgtgaagatccggagcgagaacccgcccggg
acaaccgccgaagtgattgagtacatccgcggttttctggatggcatcggcatccgatca
gaggtcttttgtgccggccagggcatggacaaccttgttgccatacaaaaggacgctacg
ctgatgctctgcggccatgttgatgttgtcccggcacccggtgacaactggagccgcccc
cccttttccggcgacatagcggagggatgtgtctgggggcggggcgcaacggacatgaaa
ggcggctgtgcggccatcctctctgcgtgcgagacccttgccgacgccgggaaagacatg
ccggcaacccttgcctttgtctgtgatgaagagaccgggggcgagaatgggacacggttc
cttcttgcaaaaaaagcactgccgccctgcgactgcatcattgccgaacccacgccctcc
ctgcatcccagcatcgggcagaaagggctctgccggatggagatagccttctccggtatc
ccggcgcacgggtcgctctaccctgccgtgggccggagtgccatcatggaagcggtgcct
tttctggaatgggtaaaaaccctgtacaaccgcgattacccggttgacgcttccctccag
gaaatcatcaatcgctcggccggggtcgtcgcaaaagagttcaggatcgatggcgtgagc
gatgtcttgcaacggctgaccttcaaccccgggacaatccatggaggggaaaagtccaat
gtcgtggctgagcgctgcactctcgaactcgagatacgggtgccgtggggctgctcgatt
ccggagaccattgccgagatccgggcgcatgctggcaatgccgttgtcaccccgcaggaa
gccttcgtccccaccatcaccgacccgtcatcgcggatcgtcacggtcacctgcaacgcg
gtacaacacgcctggaacaagccctcgttcccgttcgtgcagtgggcggcaagcgatgcc
cgccacctgaggagcgccgggttccgggttatcgagtacgggcccggcgagatcgagagc
ctgcatgccgtaaacgaacgcgtaaccatcacatcacttgagaaagccgtggagatctac
ggggacgtgatgcagcagtatgccggagagcaggcatag

DBGET integrated database retrieval system