KEGG   Methanoregula formicicum: Metfor_2133Help
Entry
Metfor_2133       CDS       T02392                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mfo  Methanoregula formicicum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mfo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2079747..2080751
Genome map
AA seq 334 aa AA seqDB search
MSTLTLNGWMERDGHRLSIPGIERLVIDRPDELSQCGGEFFLSWDSCSARDLYGIMEGTG
PKGTILCNGKATGTIAPTAPEMTLEDAIVTAVRLRSDEGVVALSGGVDSALVAALARREC
VAVGLEGSHDLKRAKAAADSLGLDCTFVTIHEEEIASALPIVVRAIPEKNPVNAGIALTL
YFVAHWAGEHGYQRIITGQGADELFGGYSRYLTTETLEEDLVRDFTGLEAQVRRDQAVAA
LHGAYFSMPYMDFRVVRAARAIPAAEKVQGGRRKIPLRTVAERHIPPDLAGYEKKAMQYG
SGVWATLRKLARKNGYKTSMQDYIDHISRVEHGH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccctgacgctgaacggctggatggagcgggacggccaccggctcagcattccc
gggatcgagagactggtaatagaccgcccggatgaactgtcgcagtgcggaggggaattc
ttcctttcctgggactcctgcagcgcccgcgacctgtacgggatcatggagggaaccggc
ccgaaaggcactattctctgcaacgggaaagccaccgggactatcgctcccacagcaccg
gagatgaccctcgaagatgcaatcgtgactgccgttcgcctccgcagcgatgagggagtc
gtggcattatcgggaggggtggactcggcgctcgtggctgcccttgcccgacgggaatgc
gttgccgtaggccttgaaggatcgcatgacctgaaacgggcgaaagctgccgcggactct
ctggggcttgactgcaccttcgtgacgatccatgaggaggagatcgcttcagctcttccg
atcgttgtcagggcaatcccggagaagaatccggtgaacgcgggaatcgctctcaccctg
tatttcgtcgcgcactgggccggggagcatggctaccagcgcatcatcaccgggcagggc
gcagacgaactcttcggcggatattcacggtaccttaccacggagacactggaagaagat
ctcgtgcgggactttaccggtcttgaagcacaggtgcggcgtgatcaggcagtggcggca
ctgcacggggcgtacttctcgatgccgtatatggacttccgtgttgtgcgcgccgcccgg
gccatccctgccgcggagaaggtgcagggcggccgccgtaagatccccttaagaacggtc
gcagaacgccacattcccccggatctcgcagggtacgagaagaaagccatgcaatacggg
agcggtgtctgggcaaccctccggaagcttgcccgtaaaaatggttataaaacgtccatg
caagattacatagaccacatcagcagggtggaacatggtcactga

DBGET integrated database retrieval system