KEGG   Methanoregula formicica: Metfor_2319Help
Entry
Metfor_2319       CDS       T02392                                 

Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mfo  Methanoregula formicica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metfor_2319
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metfor_2319
   00640 Propanoate metabolism
    Metfor_2319
   00660 C5-Branched dibasic acid metabolism
    Metfor_2319
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_2319
Enzymes [BR:mfo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metfor_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2284986..2286200)
Genome map
AA seq 404 aa AA seqDB search
MKLREYEAKNVIKAAGIPVPAGFLIRSPDELTPHLDALGTAFVLKAQVDVGGRGKAGGIL
MADKATGTKVAKDLFAKQIKGLPVKEVLAEQKLDIKHEYYLSITVDRSSRQPLILFTEAG
GVEIEVTAKEHPELIRKVVANPLMKDLPPFLIRELLGSAPKEIGPVINKLYKVFIEKDAL
LAEINPLVATPNGIFAADAKIIVDDNALGRQGITVNRDLSEREREAEKHGFSYVELDGKI
GVIGNGAGLTMATLDLIEYYGGKAANFLDVGGGAESERVKNAVRLVASVPSVKVIVVNLL
GGITKCDEVAKGIIAAEIPQKVIVRLAGTNEAEGRRLLSEKGYEMLDTMDLVVKKAVEVT
SEQPHQKKPGPWKKPNGGQHSVAVITKPESQPTSEMYQLGKGGM
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccgtgaatacgaggcaaagaatgtcatcaaagcggccgggatccccgtccct
gccggattcctgatccgatcgcccgacgaactcaccccccaccttgacgcactgggcact
gcattcgtcctgaaggcgcaggtggatgtgggcggccggggcaaggccggcggtatcctg
atggccgacaaagccacgggcacaaaggtggcaaaggatctcttcgcaaagcagatcaag
ggcctgccggtaaaggaagtccttgccgaacagaaactcgacataaaacacgagtactac
ctctccatcacggtcgaccgctcatcccggcagccgctcatcctcttcaccgaggccggc
ggggtcgagatcgaggtaaccgcaaaggagcacccggagctgatccggaaggtcgtggca
aacccgctcatgaaggacctgcccccgttcctgatccgcgaactccttggcagtgcacct
aaggagatcgggccggtcatcaacaagctgtacaaggtcttcattgaaaaagatgcactc
cttgccgagattaacccgcttgttgccactccgaacggcatctttgccgcagacgcgaag
atcatcgtggacgacaatgccctgggcaggcaggggatcacggtcaaccgcgatctctcc
gagcgggagcgggaggcggagaagcacggcttctcgtacgtggagctggacgggaagatc
ggcgtgatcggcaacggcgccgggctcaccatggcaacgcttgacctcatcgagtactat
ggcgggaaggcggcaaacttcctcgacgtgggcggcggggcagagagcgagcgcgtgaag
aacgccgtacggcttgtcgcaagcgtcccgagcgtaaaggttattgtcgtcaacctgctg
ggcggcatcaccaagtgcgacgaggtggcaaagggtatcatcgctgcggagatcccgcag
aaggtcattgtccggctcgcgggcaccaacgaggccgagggccggcgcctcctctcggag
aaggggtacgagatgctggacacgatggaccttgtcgtcaagaaggctgtcgaggtgaca
tcagaacaaccacatcaaaagaaacccggtccgtggaaaaaaccaaacggaggccaacat
tcagtagccgtaataactaagccagaatcacaacctacttccgagatgtatcagttgggt
aagggagggatgtga

DBGET integrated database retrieval system