KEGG   Methanoregula formicica: Metfor_2319Help
Entry
Metfor_2319       CDS       T02392                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mfo  Methanoregula formicica
Pathway
mfo00020  Citrate cycle (TCA cycle)
mfo00640  Propanoate metabolism
mfo00660  C5-Branched dibasic acid metabolism
mfo00720  Carbon fixation pathways in prokaryotes
mfo01100  Metabolic pathways
mfo01110  Biosynthesis of secondary metabolites
mfo01120  Microbial metabolism in diverse environments
mfo01130  Biosynthesis of antibiotics
mfo01200  Carbon metabolism
Module
mfo_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metfor_2319
   00640 Propanoate metabolism
    Metfor_2319
   00660 C5-Branched dibasic acid metabolism
    Metfor_2319
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_2319
Enzymes [BR:mfo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metfor_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AGB03323
UniProt: L0HJ42
Position
complement(2284986..2286200)
Genome map
AA seq 404 aa AA seqDB search
MKLREYEAKNVIKAAGIPVPAGFLIRSPDELTPHLDALGTAFVLKAQVDVGGRGKAGGIL
MADKATGTKVAKDLFAKQIKGLPVKEVLAEQKLDIKHEYYLSITVDRSSRQPLILFTEAG
GVEIEVTAKEHPELIRKVVANPLMKDLPPFLIRELLGSAPKEIGPVINKLYKVFIEKDAL
LAEINPLVATPNGIFAADAKIIVDDNALGRQGITVNRDLSEREREAEKHGFSYVELDGKI
GVIGNGAGLTMATLDLIEYYGGKAANFLDVGGGAESERVKNAVRLVASVPSVKVIVVNLL
GGITKCDEVAKGIIAAEIPQKVIVRLAGTNEAEGRRLLSEKGYEMLDTMDLVVKKAVEVT
SEQPHQKKPGPWKKPNGGQHSVAVITKPESQPTSEMYQLGKGGM
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccgtgaatacgaggcaaagaatgtcatcaaagcggccgggatccccgtccct
gccggattcctgatccgatcgcccgacgaactcaccccccaccttgacgcactgggcact
gcattcgtcctgaaggcgcaggtggatgtgggcggccggggcaaggccggcggtatcctg
atggccgacaaagccacgggcacaaaggtggcaaaggatctcttcgcaaagcagatcaag
ggcctgccggtaaaggaagtccttgccgaacagaaactcgacataaaacacgagtactac
ctctccatcacggtcgaccgctcatcccggcagccgctcatcctcttcaccgaggccggc
ggggtcgagatcgaggtaaccgcaaaggagcacccggagctgatccggaaggtcgtggca
aacccgctcatgaaggacctgcccccgttcctgatccgcgaactccttggcagtgcacct
aaggagatcgggccggtcatcaacaagctgtacaaggtcttcattgaaaaagatgcactc
cttgccgagattaacccgcttgttgccactccgaacggcatctttgccgcagacgcgaag
atcatcgtggacgacaatgccctgggcaggcaggggatcacggtcaaccgcgatctctcc
gagcgggagcgggaggcggagaagcacggcttctcgtacgtggagctggacgggaagatc
ggcgtgatcggcaacggcgccgggctcaccatggcaacgcttgacctcatcgagtactat
ggcgggaaggcggcaaacttcctcgacgtgggcggcggggcagagagcgagcgcgtgaag
aacgccgtacggcttgtcgcaagcgtcccgagcgtaaaggttattgtcgtcaacctgctg
ggcggcatcaccaagtgcgacgaggtggcaaagggtatcatcgctgcggagatcccgcag
aaggtcattgtccggctcgcgggcaccaacgaggccgagggccggcgcctcctctcggag
aaggggtacgagatgctggacacgatggaccttgtcgtcaagaaggctgtcgaggtgaca
tcagaacaaccacatcaaaagaaacccggtccgtggaaaaaaccaaacggaggccaacat
tcagtagccgtaataactaagccagaatcacaacctacttccgagatgtatcagttgggt
aagggagggatgtga

DBGET integrated database retrieval system