KEGG   Methanoregula formicica: Metfor_2496Help
Entry
Metfor_2496       CDS       T02392                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mfo  Methanoregula formicica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metfor_2496
   00030 Pentose phosphate pathway
    Metfor_2496
   00051 Fructose and mannose metabolism
    Metfor_2496
   00052 Galactose metabolism
    Metfor_2496
   00500 Starch and sucrose metabolism
    Metfor_2496
   00520 Amino sugar and nucleotide sugar metabolism
    Metfor_2496
  Nucleotide metabolism
   00230 Purine metabolism
    Metfor_2496
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metfor_2496
Enzymes [BR:mfo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Metfor_2496
    5.4.2.8  phosphomannomutase
     Metfor_2496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2442553..2443947
Genome map
AA seq 464 aa AA seqDB search
MPVKKMQKRLFGTNGVRGVVGKDLTPDLVMVIGQSLGSMRKGRIAVGRDTRTSGEMFIRA
LKAGLLSVGCDVVDCGILPTPALQYIVKEGFAAGAIITASHNPPEYNGVKIIEPDGTEMG
DEETVKLEDKIFSRAFSVEPWDRTGKETQGPELLTNYITAITGSFSGKPGEGMTVVVDPG
SGPASLTTPRILTDLGCRVLTINAIMDGTFPGRLPEPSLEGLMNCAALVTGSGAAFGVAH
DGDADRAVFIDEKGRFVEENLQFALIASHICRRKQGIVVTPVSTGQVAEDVVTRARSSIE
YTPVGSIYVARTMRSLLDQGKPVIFGGEGNGGLIFPEHQFCRDGGMTAAMMVSLLASTGK
KLSELVDELPPRTIIKEKIVTQKGAEIIGRLKNAYSSEKIDETDGVKIFRNGSWALIRAS
GTEPIIRVIIDSPLPEDGQAFHTEIMNCIRKAVDSGGLEASLHL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaaagaagatgcagaagcggttattcgggaccaacggggtgagaggggtagtc
ggaaaggatctcaccccggatctggtcatggtgatcgggcagtccctcgggtccatgaga
aagggccggattgcagtaggtcgtgacacgaggacatccggagaaatgtttatccgtgcc
cttaaagccgggctcctctccgtaggttgtgatgttgtcgactgcgggatcctcccgaca
ccagcactccagtacatcgtgaaagagggatttgcggctggcgccataataaccgcatcc
cacaatcccccggaatataatggcgtaaaaattatcgagcctgacggaacggaaatggga
gacgaggaaacggtgaaactcgaagataagatttttagcagggctttctccgttgagcca
tgggaccggaccgggaaagagactcaggggccggaacttcttacaaattatatcactgcg
ataacaggatcgttttccggaaagccgggggagggcatgactgttgttgtggatcccggc
tcggggccggcaagcctcaccaccccgaggattttaacggacctggggtgccgggtatta
actatcaatgcgatcatggacgggacatttcccggcaggttgccggaaccttcgttggaa
ggcctgatgaattgtgctgcgctggtcacagggagtggtgcggcatttggcgtggcgcat
gacggagatgccgaccgggccgtttttatcgacgagaaaggacggtttgttgaagagaat
ctgcagtttgcccttatcgcaagtcacatctgtcgccggaaacagggaatcgttgtcacg
ccggtgagtaccgggcaggttgcggaagacgttgtaaccagggcgcgttcatccattgaa
tatacaccggtcgggagcatttacgttgcaaggaccatgcgctcgctccttgatcaggga
aagccagtcattttcggcggcgaaggaaatggcgggttgatctttccggaacaccagttc
tgccgcgatggcggaatgaccgctgcgatgatggtctccctcctagcatctaccgggaaa
aaactctccgagcttgttgacgaacttccaccccgcaccattattaaggaaaagattgtc
acacaaaaaggagcggagataatcgggaggctgaagaatgcctattcctctgaaaaaata
gatgagaccgacggggtgaagatcttcaggaatgggtcatgggcgctcatccgcgcttcc
ggaaccgaacctataatccgagtaatcattgattccccattaccagaagatggacaggcg
tttcatacagagatcatgaactgtattcgcaaggctgttgattcgggggggcttgaggcc
tcccttcatctatag

DBGET integrated database retrieval system