KEGG   Methanoregula formicica: Metfor_2527Help
Entry
Metfor_2527       CDS       T02392                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mfo  Methanoregula formicica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metfor_2527
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metfor_2527
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metfor_2527
Enzymes [BR:mfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metfor_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2473090..2474295
Genome map
AA seq 401 aa AA seqDB search
MYHLVCVNCGATYPADEILYNCTKCGHLLAVKYPLDSLNINKAVWDKRPLGVWRYKELLP
VHGEPVTLQEGGTQMYHLKRLGEEMGIPHLYAKHEGMNPSGSFKDRGMTVGVSMALQLGK
KSVACASTGNTSASLAVYAAKAGIPAVVLLPAGKVAVGKVAQALMHGAKVISIRGNFDRA
LEMVHDLCLSHGLYLLNSINPYRLEGQKTIGFEAVDQLGGVPDRFVLPVGNAGNISAVYK
GLLELQELGFIDRLPMMTGIQAAGSSPVVRAVRENLPEVVPEMQPETVATAIRIGAPVNA
EKALTAIRKTGGLAESVTDEEILRMQRDLARKEGIGVEPASAASVAGIRKLAEMGMIDRD
ERIVCVVTGHLLKDPDTVIKQCEPPTEIDANLPSLLSALHL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatctcgtgtgcgtcaactgtggagccacctatcccgctgacgagatcctctat
aattgtacaaaatgcggccaccttcttgcggtaaaatacccgctcgattcattgaatatc
aacaaggcggtctgggacaagcggcctctcggtgtctggcgttataaggaactcctgccg
gtgcacggggagccggtgaccctccaggaaggggggacacagatgtaccacctcaagaga
ctgggtgaggaaatggggatccctcatctctatgcaaaacacgaggggatgaacccctcc
ggttccttcaaggaccggggcatgaccgtgggggtttcgatggcgctccagctgggaaag
aagagcgttgcctgcgcaagcaccggcaacacctccgccagtctcgcggtgtacgcagcg
aaggccgggatccccgccgttgtcctcctccctgccggcaaggtggccgtcggcaaggtg
gcccaggcactgatgcatggcgcaaaggtcatatccatacgcgggaactttgaccgggcc
ctcgagatggtccacgatctctgcctttcccacgggctgtacctgctgaactccatcaac
ccctaccggcttgaaggccagaagacgatcggattcgaggcagtcgaccagcttggcggt
gtcccggaccggttcgttctcccagtaggaaatgccggcaacatatccgcggtatacaag
gggctcctggaactccaggaactcgggttcatcgacaggcttccgatgatgaccgggatc
caggcagcaggttcgagcccggtggtccgtgcagtccgcgagaacctccctgaagtcgtt
cccgaaatgcagcccgagaccgtcgcaaccgcaatccggatcggtgcaccggtcaatgcc
gagaaagccctcacagccatccgcaagaccgggggccttgccgaatccgttacggacgaa
gaaatcctgcggatgcagcgcgacctcgcccgcaaggagggcatcggtgtcgagccggca
tcggctgcgtcggttgccggtatcaggaagctggcagagatgggtatgattgaccgggac
gagcggatcgtctgcgttgtcaccggccacctcttgaaagacccggacacggtgatcaaa
caatgcgaacccccgacagagatcgatgcaaacctgccctcgctgctctctgcgctgcac
ttgtaa

DBGET integrated database retrieval system