KEGG   Methanoregula formicica: Metfor_2538Help
Entry
Metfor_2538       CDS       T02392                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicica
Pathway
mfo00010  Glycolysis / Gluconeogenesis
mfo00020  Citrate cycle (TCA cycle)
mfo00620  Pyruvate metabolism
mfo00640  Propanoate metabolism
mfo00650  Butanoate metabolism
mfo00680  Methane metabolism
mfo00720  Carbon fixation pathways in prokaryotes
mfo01100  Metabolic pathways
mfo01120  Microbial metabolism in diverse environments
mfo01130  Biosynthesis of antibiotics
mfo01200  Carbon metabolism
Module
mfo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mfo_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metfor_2538
   00020 Citrate cycle (TCA cycle)
    Metfor_2538
   00620 Pyruvate metabolism
    Metfor_2538
   00640 Propanoate metabolism
    Metfor_2538
   00650 Butanoate metabolism
    Metfor_2538
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_2538
   00680 Methane metabolism
    Metfor_2538
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metfor_2538
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metfor_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF2194
Motif
Other DBs
NCBI-ProteinID: AGB03532
UniProt: L0HFL8
Position
2485473..2486015
Genome map
AA seq 180 aa AA seqDB search
MKELRIHGRGGQGSVTAAELIAVAAFEGGVYAQAFPAFGVERRGAPVQAFVRFDNKKIRK
RSQVYEPDYIIVQDSTLIKDVNVFLGVKPGGIVIVNTEKKPEFKVPDGVKLITIDATSIA
LKALGLPITNTTLMGAFAAASGEIQFSALENALKHRFPGELAVKNIAAAKTAYDTVKGAA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagctacgtatccacggcaggggtggccaggggtctgtcactgctgccgaactg
atcgcagtcgccgcattcgagggcggcgtctatgcccaggcctttccggcattcggtgtc
gagaggcggggggccccggtccaggcatttgtccggtttgacaacaagaaaatccggaag
aggagccaggtgtacgaacccgactatatcatcgtgcaggacagcaccctgatcaaagac
gtgaatgtctttttgggggtaaagcccggcgggatcgtgatcgtgaacaccgagaagaag
ccggaattcaaggtgcctgatggcgtgaaactgataaccatcgacgccacatccatcgcc
ctcaaggcgctcggcctccccatcaccaacaccacgctcatgggagcgtttgccgctgca
tcaggagagatccagttctcggcactcgaaaatgcactgaagcaccgcttcccgggtgaa
cttgcagtgaagaacatcgccgcggcaaagaccgcgtatgacaccgtgaagggggcagct
taa

DBGET integrated database retrieval system