KEGG   Methanoregula formicica: Metfor_2539Help
Entry
Metfor_2539       CDS       T02392                                 

Definition
2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
Orthology
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metfor_2539
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metfor_2539
   00020 Citrate cycle (TCA cycle)
    Metfor_2539
   00620 Pyruvate metabolism
    Metfor_2539
   00640 Propanoate metabolism
    Metfor_2539
   00650 Butanoate metabolism
    Metfor_2539
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_2539
   00680 Methane metabolism
    Metfor_2539
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metfor_2539
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metfor_2539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2486015..2486275
Genome map
AA seq 86 aa AA seqDB search
MALATGCRARPGKSRDNKTGSWRVFKPVFDHEKCSKCGMCQTLCPEGCVHEDAEGFFNPD
YDYCKGCGICAEECPKEAIAMKQEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgcgacaggatgcagggctcgccccggaaagtcgcgcgacaacaagaccgga
tcctggcgggtattcaagccggtcttcgatcatgaaaagtgctcgaaatgcgggatgtgc
cagaccctctgtcccgaagggtgcgtccacgaagatgcagaagggttcttcaatcccgat
tatgattactgcaaaggatgcgggatatgtgccgaggagtgcccgaaagaagcgattgcc
atgaaacaggaggagaagtaa

DBGET integrated database retrieval system