KEGG   Methanoregula formicica: Metfor_2541Help
Entry
Metfor_2541       CDS       T02392                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metfor_2541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metfor_2541
   00020 Citrate cycle (TCA cycle)
    Metfor_2541
   00620 Pyruvate metabolism
    Metfor_2541
   00640 Propanoate metabolism
    Metfor_2541
   00650 Butanoate metabolism
    Metfor_2541
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_2541
   00680 Methane metabolism
    Metfor_2541
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metfor_2541
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metfor_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2487435..2488343
Genome map
AA seq 302 aa AA seqDB search
MAEKKKTCDLFDCGHRACGGCGASLAARLVTEAAGPETIVVSSTGCMEVFSTPYPETAWK
VPWIHSLFENAAAVASGIDAALKKQGRKEKIVIMAGDGATFDIGMISISGAFERGHDFTY
ICYDNEAYMNTGIQRSGATPLDASTTTSPAGSQSFGNKRPKKDMPAILAAHGAPYVATAS
IAYPADLRQKVEKAINTKGPCYVQVHAPCCTGWGFEGEQTIAIAKLAIETGLWPNFEMVD
GKVTKVKKVVRKPVTEYLKTQKRFRHLFKPKLQEAEIAAIQAIADRNAEKYGLDIKLPPR
KE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagaagaagacctgcgacctgttcgactgcggccaccgtgcctgcggcggc
tgcggggcgtcgcttgctgccaggctcgtgacggaagcggctgggcccgagacgatcgtt
gtctcctccaccgggtgcatggaggttttctccaccccgtacccggagactgcatggaag
gtcccgtggatccactcgctttttgagaacgctgcggcggttgcatcgggcatcgacgct
gcgctgaagaagcagggcaggaaagagaagatcgtgatcatggcaggcgatggagcaacc
ttcgacatcggtatgatcagcatcagcggcgcattcgagcgcggccatgacttcacctac
atctgctatgacaacgaggcatacatgaacaccggcatccagcggtccggtgccacaccc
ctcgatgccagcacgaccacaagcccggccggctcccagtcgtttggcaacaagcggccc
aagaaggacatgcccgcaatccttgcagcacacggggcaccttatgtcgctacggcatcc
atcgcctatccggcagacctccggcaaaaagtcgaaaaagccatcaacaccaaggggccg
tgctatgtgcaggtccatgcaccctgctgcacgggctggggattcgagggcgagcagacc
atcgcgatcgcaaaactcgccatcgagaccgggctctggccgaacttcgagatggtggat
ggcaaggtcacgaaggtgaagaaggttgtccgcaagccggtgactgaatacttaaagacc
cagaaacggttccgccaccttttcaagccgaaactgcaggaagcggagatcgcggcaatc
caggccatcgccgaccggaatgccgagaagtacggtctcgacatcaagctcccgcctagg
aaagaataa

DBGET integrated database retrieval system