KEGG   Methanoregula formicica: Metfor_2541Help
Entry
Metfor_2541       CDS       T02392                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metfor_2541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metfor_2541
   00020 Citrate cycle (TCA cycle)
    Metfor_2541
   00620 Pyruvate metabolism
    Metfor_2541
   00640 Propanoate metabolism
    Metfor_2541
   00650 Butanoate metabolism
    Metfor_2541
  Energy metabolism
   00680 Methane metabolism
    Metfor_2541
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metfor_2541
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metfor_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2487435..2488343
Genome map
AA seq 302 aa AA seqDB search
MAEKKKTCDLFDCGHRACGGCGASLAARLVTEAAGPETIVVSSTGCMEVFSTPYPETAWK
VPWIHSLFENAAAVASGIDAALKKQGRKEKIVIMAGDGATFDIGMISISGAFERGHDFTY
ICYDNEAYMNTGIQRSGATPLDASTTTSPAGSQSFGNKRPKKDMPAILAAHGAPYVATAS
IAYPADLRQKVEKAINTKGPCYVQVHAPCCTGWGFEGEQTIAIAKLAIETGLWPNFEMVD
GKVTKVKKVVRKPVTEYLKTQKRFRHLFKPKLQEAEIAAIQAIADRNAEKYGLDIKLPPR
KE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagaagaagacctgcgacctgttcgactgcggccaccgtgcctgcggcggc
tgcggggcgtcgcttgctgccaggctcgtgacggaagcggctgggcccgagacgatcgtt
gtctcctccaccgggtgcatggaggttttctccaccccgtacccggagactgcatggaag
gtcccgtggatccactcgctttttgagaacgctgcggcggttgcatcgggcatcgacgct
gcgctgaagaagcagggcaggaaagagaagatcgtgatcatggcaggcgatggagcaacc
ttcgacatcggtatgatcagcatcagcggcgcattcgagcgcggccatgacttcacctac
atctgctatgacaacgaggcatacatgaacaccggcatccagcggtccggtgccacaccc
ctcgatgccagcacgaccacaagcccggccggctcccagtcgtttggcaacaagcggccc
aagaaggacatgcccgcaatccttgcagcacacggggcaccttatgtcgctacggcatcc
atcgcctatccggcagacctccggcaaaaagtcgaaaaagccatcaacaccaaggggccg
tgctatgtgcaggtccatgcaccctgctgcacgggctggggattcgagggcgagcagacc
atcgcgatcgcaaaactcgccatcgagaccgggctctggccgaacttcgagatggtggat
ggcaaggtcacgaaggtgaagaaggttgtccgcaagccggtgactgaatacttaaagacc
cagaaacggttccgccaccttttcaagccgaaactgcaggaagcggagatcgcggcaatc
caggccatcgccgaccggaatgccgagaagtacggtctcgacatcaagctcccgcctagg
aaagaataa

DBGET integrated database retrieval system