KEGG   Methanoregula formicica: Metfor_2665Help
Entry
Metfor_2665       CDS       T02392                                 

Definition
AMP phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mfo  Methanoregula formicica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metfor_2665
Enzymes [BR:mfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Metfor_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2592755..2594281)
Genome map
AA seq 508 aa AA seqDB search
MKLVVKNIDIAARGVLLNRLDARGMGVMNGDRVQVINPKNGLSATAFVEITSTIAQQGTL
GIYRITNERLQMEDGDDIEIREAGRPESLDYIKKKMDGGKLTKEETLTIIKDVVHDDISA
AELTAYITASYINPLDMDEVEHLTRAMVETGEQIKFASRPIVDKHSIGGVPGNKITFLVV
PIITASGLKIPKTSSRAITGAGGTADLMEVLAFVEFTAGEVQQMTDKVGGCIVWGGATNI
APADDRIIIQEYPFKIDARGQMLASVMAKKFAVGANLVVIDIPVGQNTKVANMQEGRKLA
REFIELGERLGMKVECALTYGDTPVGHSIGPKLEVIEALRVLEGSQEPNSFIQKSISIAG
IALEMAGKAPRGGGMAMAQDLLSSGKALEKMKRIIEIQGGDPNVKSSDILPGEHQFVVRA
PASGYVIEMNNRSLITLARTAGAPQDRGAGILLHAKKGKLVKAGEPLFTLYADRNWRLQK
AIEEGRRLMPVLVEGMLLDRVPSSFSEI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggttgtaaaaaatattgatattgcagcaagaggggtgctcctgaaccgcttg
gatgcccggggcatgggtgtgatgaatggcgaccgggttcaggtcatcaacccgaagaac
gggctgtcggcaacagcatttgtcgagatcacgtcaacaatcgcccagcaggggaccctc
gggatctaccgcatcaccaacgagcgcctccagatggaggatggcgatgatatcgagatc
cgcgaagcaggccggcctgaatccctcgactatatcaagaagaagatggacgggggcaaa
ctcaccaaggaagagaccctgacaatcatcaaggacgttgtccacgatgatatctctgct
gcggaactgactgcttacattacggcatcctacataaacccgcttgacatggatgaggtt
gagcatctcacccgtgcaatggtggagaccggcgaacagatcaagttcgcctcccgaccc
attgtcgacaagcactcgatcggaggggtacccggcaacaaaataacctttcttgtcgtc
cccattattacggcaagcggcctcaagatccccaagacgagttcgcgtgctatcaccggg
gccgggggtacggcagacctcatggaagtgctggcgtttgttgagtttaccgcaggcgag
gtccagcagatgaccgacaaggtaggggggtgcattgtctggggcggggcaacgaacatc
gccccggcagatgaccggatcatcatccaggaatacccgttcaagatcgatgcccggggc
cagatgcttgcgagcgtgatggcgaaaaagtttgctgtcggggcgaacctcgtcgttatc
gatattcctgtcggccagaatactaaggttgcaaacatgcaggaagggcgcaaacttgcc
cgggaattcatcgagctcggcgaacggctgggaatgaaggtggagtgtgcactcacatat
ggcgacacccctgtcggacacagtatcggtccgaaactggaggtcatcgaagcgctgcgt
gtccttgagggttcgcaggaacccaactcctttatccagaaaagcatctccattgctggg
attgcgctggagatggccggcaaggcacccaggggagggggtatggccatggcacaggat
cttctctcaagtggtaaagcgctcgagaagatgaaacggatcatcgagattcaggggggc
gatccgaatgtcaagtcatcggatatccttcccggagaacaccagtttgttgtcagggcc
ccggcatccgggtacgtgatcgagatgaacaaccgctcgctcatcacccttgcgcggact
gcgggggccccgcaggaccggggcgcggggatcctccttcacgcaaagaaaggaaagctc
gtgaaagcaggagagcccctcttcaccctgtatgcggaccggaactggaggttgcagaag
gcaatcgaggaaggccgacgcctcatgccggtccttgttgaagggatgctgctggatcgt
gtcccgtcgtcattttcggagatatag

DBGET integrated database retrieval system