KEGG   Methanoregula formicica: Metfor_2673Help
Entry
Metfor_2673       CDS       T02392                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mfo  Methanoregula formicica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metfor_2673
Enzymes [BR:mfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metfor_2673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2602348..2603037
Genome map
AA seq 229 aa AA seqDB search
MKIAVTRLKGKEKSDASRCRAYGHECFSVHPLRSELRETEIAAFVDAASAGEFDCIFFTS
ALPAKIIAPRLSTTARVIAIGPQTAKELRDYAIECETLTSFYSRDFVPYLGDWIRRKRIG
IPRADVPNQNLLDSITNAGGIVREFRCYGLEPTGEDLPLDDADAILFTSAMSYAKARWTP
RDTLLVMAIGEITAAVMNAGGTVPAVIGDGSLEGSLSALNAYLQKNGGA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcagtcacccgcctgaaaggaaaagagaagagcgacgcttcccgctgccgt
gcctacggccacgaatgcttcagcgtccacccgctcaggtcagaactgcgcgagacggag
attgccgccttcgttgatgcagcctccgccggtgagtttgactgcatcttcttcacgagc
gccctgccggcgaagatcatcgccccccgcctctcaaccactgcacgggtgattgccatc
ggcccccagacagcaaaagaactcagggattacgctatcgaatgcgaaacgctcaccagt
ttctattcccgggactttgtgccgtacctgggcgactggatccggaggaagaggattggt
atcccacgggcagatgtcccgaaccagaacctccttgactcgataacaaacgcagggggg
atcgtccgcgagttccggtgctacgggcttgagccgaccggtgaggacctccccctcgat
gatgcagatgccatcctttttaccagcgccatgtcgtatgcaaaagcccgctggacaccg
cgggacacgctcctcgtcatggctattggggaaataacggcagcggtcatgaacgccgga
gggacagttccagccgttattggtgacggttcgctcgaaggttccttgagtgcgttgaac
gcgtatctgcaaaagaacggaggtgcctga

DBGET integrated database retrieval system