KEGG   Methanoregula formicica: Metfor_2889Help
Entry
Metfor_2889       CDS       T02392                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mfo  Methanoregula formicica
Pathway
mfo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfo01100  Metabolic pathways
mfo01110  Biosynthesis of secondary metabolites
mfo01130  Biosynthesis of antibiotics
mfo01230  Biosynthesis of amino acids
Module
mfo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metfor_2889
Enzymes [BR:mfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Metfor_2889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AGB03869
UniProt: L0HLD4
Position
2782420..2783175
Genome map
AA seq 251 aa AA seqDB search
MILDDIVRRTEKRVALLPETFPEPPWDNHASLIKAIREREGKNAVIAEIKCASPSRGIIR
RNVDMAQMAGVLAGAGCVALSVLTEPYFFGGTGQDIPLVKSTVNIPVLRKDFIIDERQIA
ESRALGADAVLLIASVLGKRLPAFVDMAMDYHLEPLVEVHNADEAESALGTQATLIGINN
RNLATMTIDRSTTRILSGNIRGKGKLIVSESGMRSADDVREMRGYCDAFLIGSSIMSDKQ
PGKKLEEFVCA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatccttgatgatattgtcaggcgtacggaaaaacgggtggcgctgcttcccgaaacg
tttccggaacctccctgggacaaccatgccagcctaatcaaggccatacgggagcgggag
ggcaaaaacgctgtgatcgcagagatcaagtgtgcatcaccctcacgcggtatcatccgg
cgtaacgtcgacatggcccagatggccggcgtacttgcaggagcgggatgcgttgccctc
tcggtgctgaccgaaccctacttcttcggggggaccgggcaggacatccctcttgtcaaa
tcaacagtgaatattccggtgctccggaaggatttcatcattgatgaacgccagatcgcg
gaatcgcgtgctctcggtgcagatgccgtgctcctgatagcctcagtgctggggaagcgc
ctgccggcattcgtcgatatggcaatggattatcatctcgaaccgctggtggaagtccac
aatgctgatgaagccgaatccgcgctcggtacgcaggcaaccctgatcggcatcaacaac
cgtaatcttgccaccatgaccatcgaccgttcaaccacacgtatcctttccggaaatatc
agaggaaaagggaagctgatcgtatcggagagcgggatgcgatctgccgatgatgtccgc
gagatgaggggatactgcgatgcgttcctcatcggttcatctatcatgtccgacaagcaa
ccgggaaagaagctggaggagttcgtatgcgcataa

DBGET integrated database retrieval system