KEGG   Methanoregula formicica: Metfor_2889Help
Entry
Metfor_2889       CDS       T02392                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mfo  Methanoregula formicica
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metfor_2889
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metfor_2889
Enzymes [BR:mfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Metfor_2889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2782420..2783175
Genome map
AA seq 251 aa AA seqDB search
MILDDIVRRTEKRVALLPETFPEPPWDNHASLIKAIREREGKNAVIAEIKCASPSRGIIR
RNVDMAQMAGVLAGAGCVALSVLTEPYFFGGTGQDIPLVKSTVNIPVLRKDFIIDERQIA
ESRALGADAVLLIASVLGKRLPAFVDMAMDYHLEPLVEVHNADEAESALGTQATLIGINN
RNLATMTIDRSTTRILSGNIRGKGKLIVSESGMRSADDVREMRGYCDAFLIGSSIMSDKQ
PGKKLEEFVCA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatccttgatgatattgtcaggcgtacggaaaaacgggtggcgctgcttcccgaaacg
tttccggaacctccctgggacaaccatgccagcctaatcaaggccatacgggagcgggag
ggcaaaaacgctgtgatcgcagagatcaagtgtgcatcaccctcacgcggtatcatccgg
cgtaacgtcgacatggcccagatggccggcgtacttgcaggagcgggatgcgttgccctc
tcggtgctgaccgaaccctacttcttcggggggaccgggcaggacatccctcttgtcaaa
tcaacagtgaatattccggtgctccggaaggatttcatcattgatgaacgccagatcgcg
gaatcgcgtgctctcggtgcagatgccgtgctcctgatagcctcagtgctggggaagcgc
ctgccggcattcgtcgatatggcaatggattatcatctcgaaccgctggtggaagtccac
aatgctgatgaagccgaatccgcgctcggtacgcaggcaaccctgatcggcatcaacaac
cgtaatcttgccaccatgaccatcgaccgttcaaccacacgtatcctttccggaaatatc
agaggaaaagggaagctgatcgtatcggagagcgggatgcgatctgccgatgatgtccgc
gagatgaggggatactgcgatgcgttcctcatcggttcatctatcatgtccgacaagcaa
ccgggaaagaagctggaggagttcgtatgcgcataa

DBGET integrated database retrieval system