KEGG   Methanoregula formicica: Metfor_2908Help
Entry
Metfor_2908       CDS       T02392                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metfor_2908
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metfor_2908
   00020 Citrate cycle (TCA cycle)
    Metfor_2908
   00620 Pyruvate metabolism
    Metfor_2908
   00640 Propanoate metabolism
    Metfor_2908
   00650 Butanoate metabolism
    Metfor_2908
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_2908
   00680 Methane metabolism
    Metfor_2908
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metfor_2908
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metfor_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2797439..2798395
Genome map
AA seq 318 aa AA seqDB search
MINNDRSQDRVLRSPIIHNHLQELDTIPEIPKEEYILKCTSACAGCSDSLSLRYVLKAAG
PDTVLVVPACCTSVIQGIYPNTAFNVPVYNIAFGAAAACASGMSNAFRAAGKKTNVIVYA
GDGGTLDIGIQAMSGAFERGTDFLYICYDNEAYGNTGMQRSSGTPLGARTTTTPAGKTDA
KKDIDAIAAAHDLPYQATACAAYPQDLFKKVQKALAIRGPSFIHILAPCPPGWRYSTEKS
VEMGKLAVKSGMWVLYEREYGKLTIGPQSKVAMKKPIPLEDYLKPQGRFKGIDPKTVDIL
KQRIAKNFAKLAAEEATP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgataaataatgatagatctcaagaccgcgtattgcgctctccgatcattcacaaccac
ctgcaggagttggacaccatcccagaaatacccaaagaagaatacatcctgaagtgcaca
tcagcctgtgccgggtgcagcgattcgctctccctccggtacgtgctcaaggcagcagga
ccggatacggtcctcgttgtgccggcatgctgcacgagcgtcatccagggcatctaccct
aacacagccttcaacgttcctgtctacaacatcgcgttcggtgctgctgctgcgtgcgcc
tcgggcatgagcaacgcgttccgggcagccgggaaaaagaccaacgtcattgtctatgcc
ggtgacggcgggacgctcgatatcggtatccaggcgatgtccggagcgttcgagcggggc
acggacttcctctatatctgttatgataacgaggcgtacggcaacaccggtatgcagcgt
tcgagcggtacgccgctcggggcacggactaccacaaccccggcagggaaaaccgatgcc
aaaaaggacatcgatgccatcgccgccgcgcatgatctgccctaccaggctacggcctgc
gcagcttacccgcaggacctgttcaaaaaagtacagaaagccctcgcgatccggggcccg
tcattcatccatatcctcgccccctgcccgcccgggtggcgctactcaacagagaagagc
gttgagatgggcaagctcgcagtaaagtcaggtatgtgggtgctgtacgagcgtgagtac
gggaaactcaccatcggcccgcagtcgaaggtggcaatgaaaaagcccataccgcttgag
gattacctcaagccgcagggccggttcaagggcattgatcccaagacggttgatatcctg
aaacagcgtattgcaaagaactttgcaaagctggctgcagaggaggcgacgccatga

DBGET integrated database retrieval system