KEGG   Methanoregula formicicum: Metfor_2908Help
Entry
Metfor_2908       CDS       T02392                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicicum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mfo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mfo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mfo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mfo00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mfo00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mfo00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2797439..2798395
Genome map
AA seq 318 aa AA seqDB search
MINNDRSQDRVLRSPIIHNHLQELDTIPEIPKEEYILKCTSACAGCSDSLSLRYVLKAAG
PDTVLVVPACCTSVIQGIYPNTAFNVPVYNIAFGAAAACASGMSNAFRAAGKKTNVIVYA
GDGGTLDIGIQAMSGAFERGTDFLYICYDNEAYGNTGMQRSSGTPLGARTTTTPAGKTDA
KKDIDAIAAAHDLPYQATACAAYPQDLFKKVQKALAIRGPSFIHILAPCPPGWRYSTEKS
VEMGKLAVKSGMWVLYEREYGKLTIGPQSKVAMKKPIPLEDYLKPQGRFKGIDPKTVDIL
KQRIAKNFAKLAAEEATP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgataaataatgatagatctcaagaccgcgtattgcgctctccgatcattcacaaccac
ctgcaggagttggacaccatcccagaaatacccaaagaagaatacatcctgaagtgcaca
tcagcctgtgccgggtgcagcgattcgctctccctccggtacgtgctcaaggcagcagga
ccggatacggtcctcgttgtgccggcatgctgcacgagcgtcatccagggcatctaccct
aacacagccttcaacgttcctgtctacaacatcgcgttcggtgctgctgctgcgtgcgcc
tcgggcatgagcaacgcgttccgggcagccgggaaaaagaccaacgtcattgtctatgcc
ggtgacggcgggacgctcgatatcggtatccaggcgatgtccggagcgttcgagcggggc
acggacttcctctatatctgttatgataacgaggcgtacggcaacaccggtatgcagcgt
tcgagcggtacgccgctcggggcacggactaccacaaccccggcagggaaaaccgatgcc
aaaaaggacatcgatgccatcgccgccgcgcatgatctgccctaccaggctacggcctgc
gcagcttacccgcaggacctgttcaaaaaagtacagaaagccctcgcgatccggggcccg
tcattcatccatatcctcgccccctgcccgcccgggtggcgctactcaacagagaagagc
gttgagatgggcaagctcgcagtaaagtcaggtatgtgggtgctgtacgagcgtgagtac
gggaaactcaccatcggcccgcagtcgaaggtggcaatgaaaaagcccataccgcttgag
gattacctcaagccgcagggccggttcaagggcattgatcccaagacggttgatatcctg
aaacagcgtattgcaaagaactttgcaaagctggctgcagaggaggcgacgccatga

DBGET integrated database retrieval system