KEGG   Methanoregula formicicum: Metfor_2910Help
Entry
Metfor_2910       CDS       T02392                                 

Definition
2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicicum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mfo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mfo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mfo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mfo00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mfo00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mfo00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2799497..2800024
Genome map
AA seq 175 aa AA seqDB search
MFEIRIHSRGGQGGVTAARLLALAAIHDGKYATAAPFYGAERRGAPIVSFVRIDDKPIRI
YSQIKKPDMVIVLDASVMDVVDVLQGLKNGGKVLVNSQQKKDFPGFSSSNVDLTGIALRE
NLVVSGSPILNTPVIGALAKQGLVSAESAKKAIKEMFSDERNVKAAEAAYQEMSA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagatccgcatccattcccggggcgggcagggcggtgttaccgcagcccggctc
ctcgcccttgcagcgatccacgatggcaagtacgcaacggcagcaccgttctatggggcc
gagcgcaggggcgcaccgatcgtctcgtttgtccggatcgatgacaagccaatccggatc
tacagccagatcaaaaagcctgacatggtaatcgtgcttgatgcaagcgtcatggacgtg
gtcgatgtgctgcagggcctgaagaacgggggaaaggtcctggtcaacagccagcagaag
aaagacttccccgggttctcgtcaagcaatgtcgaccttaccggcatcgccttacgggag
aaccttgtggtctccggaagccccatcctcaatacaccggtgatcggtgcccttgcaaaa
cagggcctggtctccgcggagtccgcaaagaaagccatcaaggagatgttctccgatgag
cggaacgtgaaagctgccgaggcagcataccaggagatgagcgcatga

DBGET integrated database retrieval system