KEGG   Mycoplasma fermentans PG18: MBIO_0596Help
Entry
MBIO_0596         CDS       T02594                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mfp  Mycoplasma fermentans PG18
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mfp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664601..665425
Genome map
AA seq 274 aa AA seqDB search
MMPELPEVRSVVKDLRPKVVNRKIVKIDILHPKLIKEVSVEEFKNFLINETFLDVNNLAK
HIIFSLTNNKYLLSHLRMSGKYFTHYKYRPATKHDYLIFHLDDNSCIYYNDSRQFGTFHI
KTKGTLYTTKPLDKVAKIPSETNIKELFNKIKNKNIPIKQLLLDQSFVSGIGNIYANETL
FATQINPLTPSKNITFEQLEKIIKAAAKIMDQATELGGSSIDTYTSVDGVKGQFQDFLQV
HGHFNDVCKRCKKAKINKIFINKRGTYYCPNYQK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
attatgccagaattaccagaagttagaagtgtggtcaaagatttaagacctaaagttgtt
aatagaaaaatagttaaaattgatatcttacatcctaaattaattaaagaggtaagtgtt
gaagaattcaagaattttttaattaatgaaacatttttagatgtcaataatttagctaaa
catattattttttctttaacaaataataaatatttattaagccacttgagaatgagtgga
aagtattttacacattataaatatcgtccagcaacaaaacatgattacttaatttttcat
cttgatgataatagttgtatttattataatgactcacgtcaatttggcacttttcatata
aaaactaagggcactttatatacaactaaacctttagataaagttgcaaaaattccttca
gaaacaaatattaaagagttatttaataaaattaaaaataagaatatacctataaaacag
cttcttttggatcaaagctttgtttcaggtattggaaatatttatgctaatgaaacttta
tttgccactcaaattaatcctttgacgccttcaaaaaatataacttttgaacagttagaa
aaaattattaaagcagctgcaaaaattatggatcaagctactgaattaggtggttcaagc
attgacacatatacttcagttgatggagttaaaggtcaatttcaagattttttacaagtt
catggacactttaatgatgtatgtaaaagatgtaaaaaagctaaaattaataaaattttt
attaacaaaagagggacttattattgtccaaattatcaaaaataa

DBGET integrated database retrieval system