KEGG   Mycoplasma fermentans JER: MFE_02730Help
Entry
MFE_02730         CDS       T01325                                 

Gene name
ruvA2
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mfr  Mycoplasma fermentans JER
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MFE_02730 (ruvA2)
Enzymes [BR:mfr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MFE_02730 (ruvA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
309940..310542
Genome map
AA seq 200 aa AA seqDB search
MVLYRIGEIVYKNNQNLIFESQGVGYSIIFPDHARVEAKQKMKLYLYEIRNDYTWSLYGF
KDFKERLLFMDLINLNGIGPRVAFNILNQGWEKVASLIALGKVDHLIEIPYINPRIARIV
VGELQDKWAKITNTQDAQKQVKNSNLLSEAKETLKMLGFKAAQIDSALTKVELNQDVESM
IEEAIKFISQSGAQNEQLNA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggttttatatcgaatcggagaaattgtttataaaaataatcaaaatttaatttttgaa
agtcaaggagtaggttattcaataatctttccagatcatgctagagttgaagctaaacaa
aaaatgaagttgtatctatatgaaataagaaacgattacacttgatctttatatggattt
aaagatttcaaagaacgcttattatttatggacttaattaatttaaatggaattggacca
agagttgcttttaacatccttaaccaaggatgagaaaaagttgcatctttaattgcttta
ggtaaagtagatcacctaattgaaattccttatattaatccaagaattgctcgaattgta
gttggcgaattacaagacaaatgagctaaaataactaatactcaagatgcacaaaaacaa
gttaaaaattcaaatttattaagtgaagctaaagaaacattaaaaatgttaggctttaaa
gcagctcaaattgattcagcattaactaaagttgaattaaatcaagatgttgaatcaatg
attgaagaagcaattaaatttatttctcaaagtggtgctcaaaatgaacagcttaatgct
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system