KEGG   Mycoplasma fermentans JER: MFE_03840Help
Entry
MFE_03840         CDS       T01325                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfr  Mycoplasma fermentans JER
Pathway
mfr00010  Glycolysis / Gluconeogenesis
mfr00051  Fructose and mannose metabolism
mfr01100  Metabolic pathways
mfr01110  Biosynthesis of secondary metabolites
mfr01120  Microbial metabolism in diverse environments
mfr01130  Biosynthesis of antibiotics
mfr01200  Carbon metabolism
mfr01230  Biosynthesis of amino acids
Module
mfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_03840 (tpiA)
   00051 Fructose and mannose metabolism
    MFE_03840 (tpiA)
   00562 Inositol phosphate metabolism
    MFE_03840 (tpiA)
Enzymes [BR:mfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MFE_03840 (tpiA)
Exosome [BR:mfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MFE_03840 (tpiA)
  Exosomal proteins of bladder cancer cells
   MFE_03840 (tpiA)
  Exosomal proteins of melanoma cells
   MFE_03840 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM MIF4G DUF1848
Motif
Other DBs
NCBI-ProteinID: ADN68980
Position
453070..453786
Genome map
AA seq 238 aa AA seqDB search
MNKNFTETMDFILSFKDEYKKLKKNKEAYAISQLNEFAVAIPHANLSAYQINKVNELKLC
AQDVSQNCNGAFTGDVSASMLQDLNVNYVILGHSERRQYHHETNELVNLKAKQALEYNLT
PVICVGETLEQYEKGQTKAIVKKQIEESLKDLDYSKIIVAYEPIWAIGTGKVATPEIAQD
VCQYIHSITSKELVVQYGGSVNPKNISDLAAQKDINGFLVGGASLNVDSFIKLITLGK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaattttacagaaaccatggactttattttatcttttaaagatgaatacaaa
aaattaaagaaaaacaaagaagcatatgcaattagtcaactaaatgaatttgctgttgca
atacctcatgctaatttatcagcttatcaaattaacaaagttaatgaattaaaactatgt
gctcaagatgttagtcaaaattgcaatggtgcttttacaggtgatgttagcgcttcaatg
ctacaagatcttaatgttaactatgtaattctaggtcactcagaaagaagacaatatcat
cacgaaacaaatgagttagttaacttaaaagctaaacaagctcttgaatacaatttgaca
ccagttatttgtgttggtgaaacattagaacaatatgaaaaaggtcaaacaaaagcaatt
gttaaaaaacaaattgaagaaagtttaaaagatttagattattcaaaaattatagttgct
tatgaaccaatttgagctattggaacaggtaaagttgcaactcctgaaattgctcaagat
gtttgccaatacattcactcaattacaagtaaagaattagttgttcaatatggcggtagt
gtaaatcctaaaaatattagcgatttagcagcacaaaaagacatcaacggattcttagtt
ggtggtgcaagtttaaatgttgattcatttattaaacttattactttaggcaaataa

DBGET integrated database retrieval system