KEGG   Mycoplasma fermentans JER: MFE_03980Help
Entry
MFE_03980         CDS       T01325                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mfr  Mycoplasma fermentans JER
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFE_03980 (pfk)
   01230 Biosynthesis of amino acids
    MFE_03980 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_03980 (pfk)
   00030 Pentose phosphate pathway
    MFE_03980 (pfk)
   00051 Fructose and mannose metabolism
    MFE_03980 (pfk)
   00052 Galactose metabolism
    MFE_03980 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MFE_03980 (pfk)
Enzymes [BR:mfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MFE_03980 (pfk)
Protein phosphatases and associated proteins [BR:mfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MFE_03980 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466691..467683
Genome map
AA seq 330 aa AA seqDB search
MKKIKRIAILTSGGDAPGMNSAIRAAAKMARSRGIETFLVYEGYKGLVDDNIVPSTKIDL
DFFNSRGGTCIYSARYPQFKDPEIREIAIKNLNKRKIDALIVIGGDGSYAGAQLLHEKGI
KTIGLPGTIDNDIASSDFTIGYDTALNTVVRCIDQIRDTAASHKRIMIIEVMGNNCGDLA
LHTGLATGAEVIATSEYRLDEKEIVKTCVELTTNAKPVRRNITIVVSEKLYNIKQLAKDI
EKATGWETRPNVLGYIQRGGNPSAQERILASLFGIKAVECLLEGKSGVAIGIIDNDIVAS
PIPEALSMINKSKAKVRDKAIKFNELNRLD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaagagaattgctattctaacttcaggtggcgatgctcctggaatgaat
agtgcaattagagcagcagctaaaatggctcgtagtcgtggaattgaaacatttttagta
tatgaaggttacaaaggattagttgatgataatattgtgccttcaacaaaaattgattta
gatttctttaacagtcgtggaggcacttgtatttattcagcaaggtatcctcaatttaaa
gatccagaaattcgtgaaattgctattaaaaatttaaacaaacgtaaaattgatgctttg
atagttattggtggtgatggttcttatgcaggagcacaattattacatgaaaaaggaatt
aaaactattggacttccagggacaattgataatgatatagcttcaagtgattttactatt
ggctatgatacagctttaaatacagttgttagatgtattgaccaaattagagatacagca
gcaagtcataaaagaattatgattattgaagttatgggtaataactgtggtgacttagca
ttacacacaggacttgcaacaggggcagaagttattgcaacaagtgaataccgtcttgat
gaaaaagaaatagttaaaacttgtgttgaattaactacaaatgctaaacctgttagaaga
aatattacaatagttgttagtgaaaaattatataacattaaacaactagctaaagacatt
gaaaaagcaacaggatgagaaactagacctaatgttttaggatacattcaacgtggtggt
aatccttcagctcaagaaagaattctagcttcactttttggaattaaagctgttgaatgt
ttacttgaaggtaaaagcggtgtggctattggaattattgataatgatattgttgcttca
ccaatcccagaagcattaagtatgattaataaatctaaagctaaagttagagataaagca
attaaatttaatgaattaaaccgtttagattaa

DBGET integrated database retrieval system