KEGG   Mycoplasma fermentans JER: MFE_05250Help
Entry
MFE_05250         CDS       T01325                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfr  Mycoplasma fermentans JER
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MFE_05250 (galU)
   00052 Galactose metabolism
    MFE_05250 (galU)
   00500 Starch and sucrose metabolism
    MFE_05250 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MFE_05250 (galU)
Enzymes [BR:mfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MFE_05250 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614639..615466)
Genome map
AA seq 275 aa AA seqDB search
MTKIIHKELVPILDTPVIDRLVNEALDSGIEEILIVLSERKKDLLKFFSVDQDLQTELII
KGKKDILEKVKRTNRSSCITRVIQKEQFGLGHALASCKEYIDNEPFAIILGDDLIKSKTP
AIKQLIEFYNKTGANVIGVQSVAKEYIHKYGIVNPINLKDKDKKYFEINGAVEKPKADKA
PSNKAILGRYVFNPEILDILSRIEYDGKNEIQAVDAFDELMKKYKQKIYAYEFEGIRYDL
GSMEGFVKANIDYALEEPEIADKIKSFINEKVKEF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattcataaagaattagtgcctattcttgatacacctgttattgataga
ttagttaatgaagcacttgattcaggtattgaggaaattttaattgttttaagtgaaagg
aaaaaggatttattaaaatttttctcagttgatcaagatttacaaacagaattaattatc
aaaggtaaaaaagatattttagaaaaagttaaaagaacaaatcgctcttcatgtattact
agagtaattcaaaaggaacaatttggtttaggtcatgcacttgcaagttgtaaagaatat
attgacaatgagccgtttgctattattttaggtgatgacttaattaaatcaaaaactcct
gctattaagcaattaatcgagttttataataaaactggagcaaatgttattggtgtacaa
tcagtagcaaaagaatatattcataaatatggaattgttaatccaataaacttgaaagat
aaagataagaaatattttgaaattaatggtgcagttgaaaaacctaaggctgataaagca
ccatcaaataaagctatacttggacgttatgtctttaatccagaaattttagatatctta
tctagaattgaatatgatggcaaaaatgaaattcaagcagttgatgcatttgatgaatta
atgaaaaaatataaacaaaaaatttatgcctatgaatttgaaggcatcagatatgatctt
ggatcaatggaaggctttgttaaagcaaacattgattatgctttagaagaacctgaaatt
gcagacaagattaaaagttttattaatgaaaaagttaaagaattttaa

DBGET integrated database retrieval system