KEGG   Mycoplasma fermentans JER: MFE_06650Help
Entry
MFE_06650         CDS       T01325                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mfr  Mycoplasma fermentans JER
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_06650
Enzymes [BR:mfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MFE_06650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749135..750037
Genome map
AA seq 300 aa AA seqDB search
MSFSKKFLWGTAFAANQIEGAYNEENKGLNVQDVLPKGALGHIDLNLKEFNIKRKAIDFY
HKYQEDLDLLSEMGIKVLRISIAWSRIFPKGDESKPNQKGLEFYLKLFKELKRRKIKTIV
TLCHYEMPLHLALKYNGFSNKKVVKYFLKYAKVVLKYFNKYIDYLVAFNEINSLLHIPFC
NGGIYKNQEDLNILYQATHNMLYASAKVKEMIKNNYNHIQVGSMVLAMPFYTKSAKVEDQ
ILKMEKEWQNLYFTDVLARGVYPKYLDNYFLKNNIKINKTKEELEVIKNNIVDYIGFSYC
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagttttagtaaaaagtttttatgaggtactgcttttgcagctaatcaaattgaaggt
gcttataatgaagaaaataagggtttaaatgtccaagatgtattacctaaaggtgcttta
ggtcatattgatttaaatttaaaagaatttaatattaaaagaaaagctattgatttttat
cataaatatcaagaagatttagatcttttaagtgaaatgggaattaaagttttaagaatt
tcaattgcttgaagtcgaatttttccaaaaggtgatgaaagtaaacctaatcaaaagggt
cttgagttttatcttaaattgtttaaagaattaaagagaagaaaaataaaaacaatagtt
actctttgtcattatgaaatgcctttacatttagcacttaaatacaatggttttagtaat
aaaaaagttgttaaatactttttaaagtatgctaaagtagttctaaaatactttaataaa
tacatagattatttagtagcttttaatgaaattaattcacttttacatattcctttttgt
aatggcggaatttacaaaaatcaagaagatttaaatattttatatcaagcaactcataat
atgctttatgcttctgctaaagtcaaagaaatgattaaaaataattacaatcatattcaa
gtaggttcaatggtattagctatgcctttttatactaaaagcgcaaaagtagaagatcaa
atattgaaaatggaaaaagaatgacaaaatctttattttactgatgttttagctcgcggc
gtttatcctaaatatttagataattattttttaaaaaataatataaaaattaataagact
aaagaagaactggaagtgattaaaaataatatagtagattatattggttttagttactgt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system