KEGG   Mycoplasma fermentans JER: MFE_06880Help
Entry
MFE_06880         CDS       T01325                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mfr  Mycoplasma fermentans JER
Pathway
mfr00010  Glycolysis / Gluconeogenesis
mfr00020  Citrate cycle (TCA cycle)
mfr00620  Pyruvate metabolism
mfr01100  Metabolic pathways
mfr01110  Biosynthesis of secondary metabolites
mfr01120  Microbial metabolism in diverse environments
mfr01130  Biosynthesis of antibiotics
mfr01200  Carbon metabolism
Module
mfr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_06880
   00020 Citrate cycle (TCA cycle)
    MFE_06880
   00620 Pyruvate metabolism
    MFE_06880
Enzymes [BR:mfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MFE_06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: ADN69263
Position
complement(779304..780254)
Genome map
AA seq 316 aa AA seqDB search
MKIKSTPIARAMAAKLGIDINLVPGSGIDGRILIEDIQKFKNSPISCAAHSNFAPAPVAD
NKVITQPSAVAPKATPAPRPAIDRSAHSEAITPIRKAISKAMTNSWSNVAYTNLVHEIDM
TALWDLRSRIKDIVLKSDNVKITFLPYIIKAAAIALRDFPVFTAKYNEANQTLDYPGVIN
VGIAVDTEAGLMVPVINNADNLSIVNIANEVTRLAGAARNRTIKPAEMKGAGFTITNYGS
VGSLFGVPVINYPELAIGGVGAIIDKPVVKNGQVVPGKVMYLTVAADHRWIDGAVIGRFA
SRIKELLEKPDVLGVY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaatcaacccctattgcaagagctatggctgctaaacttggaattgatatt
aacttagttccaggttcaggaattgatggccgtattcttatagaagatattcaaaaattt
aaaaacagtcctatttcatgtgctgctcattcaaactttgcaccagctccagtagctgat
aataaagtaattactcaacctagtgcagtagctcctaaagctactccagcacctcgtcct
gccattgatcgttcagctcactcagaagctattactccaattagaaaagcaatttctaaa
gctatgactaactcatgaagtaatgttgcttatacaaatttagttcacgaaattgatatg
actgctctttgagacttacgttcaagaatcaaagatattgtacttaaaagtgataatgta
aaaattacattcttgccttatattattaaagcagctgctattgctttaagagattttcca
gtattcactgctaaatataatgaagcaaatcaaactctagattaccctggtgtaattaat
gttggtattgctgttgatactgaagctggtttaatggttcctgttattaataatgctgat
aatttaagtattgttaatattgctaacgaagtaactagacttgcaggcgctgcaagaaat
agaacaattaaacctgctgaaatgaaaggtgccggttttactattactaactatggttca
gttggatcactttttggagttcctgttattaactatccagaattagctattggtggtgtt
ggtgctattattgacaagcctgtagttaaaaatggacaagttgtacctggaaaagttatg
tacctaactgtcgctgctgatcaccgttgaattgatggtgccgtaattggaagattcgct
tcaagaatcaaagaattattagaaaaaccagatgttttaggagtgtattaa

DBGET integrated database retrieval system