KEGG   Mycoplasma fermentans JER: MFE_07350Help
Entry
MFE_07350         CDS       T01325                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mfr  Mycoplasma fermentans JER
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mfr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823690..824298
Genome map
AA seq 202 aa AA seqDB search
MNIMNNLISKRKPIIIFTGPSGVGKGTIEKYLFDFKNLKLHLSCSATTRAPREGEINGIH
YFFITKEEFEKHIQNDDLFEYSFHFDNYYGTLYSEIARIHRNGEIPVLEIETNGAKQILE
KVSNNKNYKLITLFILPPSIEELERRIINRKTESQEAIKKRLAKAQAEIAEKGIFRHHII
NDDPLRAAKEIKEIIEKEYGIK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatgaacaatttaattagcaaacgtaagccaataataatatttacaggacct
agcggagttggcaaaggaacaattgaaaagtacctttttgattttaaaaatttaaaatta
catttatcatgttcagcaacaactagagctcctcgtgaaggtgaaattaatggcattcat
tacttttttataacaaaagaagaatttgaaaaacacattcaaaatgatgatctttttgaa
tacagttttcattttgataattattatggaacactttatagtgaaattgcaagaattcat
agaaatggcgaaattcctgttttagaaattgaaaccaatggtgcaaaacaaatattagaa
aaggtttcaaataacaagaattacaaattgatcacactttttatcttacctccttcaatt
gaagaacttgaaagaagaattattaaccgaaagacagaaagtcaagaagctattaaaaaa
cgtttagctaaagcgcaagcagaaatagcagaaaaaggaatatttagacatcacataatt
aatgatgaccctttaagagctgcaaaagaaataaaagaaattatagagaaagaatacggt
atcaaataa

DBGET integrated database retrieval system