KEGG   Mycoplasma fermentans JER: MFE_08210Help
Entry
MFE_08210         CDS       T01325                                 

Definition
(RefSeq) Glucokinase (EC:2.7.1.2)
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mfr  Mycoplasma fermentans JER
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MFE_08210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_08210
   00052 Galactose metabolism
    MFE_08210
   00500 Starch and sucrose metabolism
    MFE_08210
   00520 Amino sugar and nucleotide sugar metabolism
    MFE_08210
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MFE_08210
   00524 Butirosin and neomycin biosynthesis
    MFE_08210
Enzymes [BR:mfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MFE_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
912137..913018
Genome map
AA seq 293 aa AA seqDB search
MKIATADIGGTNTRFALFKKNKFWSKVKFETNKNNYRETLNHIAHLCNLHKIECLALCIP
GPADYDKGIVLNTPNLPGWVNKNIKKYLFKHTNLKEIITENDANVMALANHKYYKQKKSD
VTQFFTVSTGLGAGLIINDQIYVGKNHLAQEIARAPLGTDEDDSFHLLPYSVELYASGTG
IELRYNKLTGEKLNAKKIFALYPNNENAKKIINEGIDSLARTISTSLAFLNPSLVVFGGS
VSEHNNWFIEKAIEKAKTYTIKSQYQNVKFAFDPYTDFSAVMGLYCLAKDKFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaacagcagatattggcggaacaaatacaagattcgctttatttaaaaaa
aataaattttgatctaaagttaaatttgaaactaataaaaataattatcgtgaaacttta
aatcatattgctcatttatgcaatttgcataaaatagaatgcttggctttatgtattcca
ggaccagccgactatgacaaaggaatagttttaaatacacctaatttacctggttgagtt
aacaaaaacattaaaaaatatttatttaagcatactaatctaaaagaaataattactgaa
aacgatgctaatgttatggctttggcaaatcacaaatattacaaacaaaagaaaagtgat
gtaactcaatttttcacagtatcaacaggtttaggtgctggtcttattattaatgatcaa
atatatgttggtaaaaatcacttagctcaagaaatcgcgagagcacctttaggtactgat
gaagatgactcatttcatttacttccttattcagtggaattgtatgcttcaggaacaggc
attgaattaagatataacaaattaacaggagaaaaattaaacgctaaaaaaatttttgct
ttatatccaaataatgaaaatgcaaaaaaaataataaatgaaggtatagattctttagct
agaactatctcaacttctttagcttttttaaatccaagtcttgttgtttttggcggtagt
gttagtgaacataataattggtttatagaaaaagctattgaaaaagctaaaacatataca
attaaatctcaatatcaaaatgtaaaatttgcttttgatccttatacagatttcagcgct
gtaatgggtttatattgtttagcaaaagataaatttaaataa

DBGET integrated database retrieval system