KEGG   Mycoplasma fermentans JER: MFE_08710Help
Entry
MFE_08710         CDS       T01325                                 

Gene name
recD
Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mfr  Mycoplasma fermentans JER
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mfr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(974756..976996)
Genome map
AA seq 746 aa AA seqDB search
MQAKTTIKVKGTIKKIRKGLAQKWILFEFKSQENQLFVVYARISSDDFLQVGYLYEMELS
GPNKYNNYILEGYNMIEATKEDLKVMLKNHIRGFKEEDHNILKENLGENYLDVIKDTPKE
ERKIFYEFIKPPLLKKIEAFIEEVLNMGKDERFFITNNIYNFYIKLKQKLPLADGESYLD
FFDKNKENHEDPYLILYIELGLSFDSVDNFASLIGYSKDCETRYYAIVYKSIYDFGIQVN
DTYYNLSDLHKNWLEFTNELILNNKLSISKLAIDNVFINSINKLIEMQKLYYAEKEVPTI
ALSFIKEQEDFIFEKLITIKNKINKTIPQIEDDTLTAKQLDALNIALNEPISIISGFPGT
GKTYLISNIYESLIAQKVYKKGEIEILTPTGRAAINIKNKSNNLPAKTIHNYLKIDKEDE
DVVYNNDCDKTKVVIIDEFSMVNLKIFYQLLSHLSKLEKLIIVGDKDQLPCIGPGNLMHD
LCNWDFIPKTLLIENQRAESDEICEHFLSIIDSKVKEVEIGSTNTIQMKEINSVALLNEL
SYLYQTYNPEYNSEKMVTLIPLHDGQVGAKTVNKWLQKEKLNNYTYKLPKFKQSKDNYIQ
SWEGTKFYLFDNVIQLINDYEKNVFNGEIGIIKEIIDDKIVSVEYPQGGNKFKTVNYVKS
EIAINLSLAYALTVHKFQGSEAPHVVIPVFKDYSRMLNKKLLYTAVSRAKEKLFILGDLA
LYAKKTKTEDYSKIKTYLFDLIKEQN
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaaacaacaataaaagtaaaaggaacaataaaaaaaataagaaaaggattg
gctcaaaagtgaattctttttgaatttaaatctcaagaaaaccaattatttgttgtctat
gctcgaattagttccgatgactttttacaagttggttatttatatgaaatggaattaagt
gggcctaataaatataataattacatacttgaaggctacaatatgattgaagcaacaaaa
gaagatttaaaagttatgttgaagaatcatattagaggttttaaagaagaagatcataat
attttaaaagaaaatttaggtgaaaattatttagatgttattaaagatacacctaaagaa
gaaagaaaaatattttacgaatttattaaaccccctttgcttaaaaaaatagaagctttt
attgaagaagttctaaacatgggcaaagatgaaagattttttataaccaataatatttac
aatttttatattaaattgaagcaaaaattacctcttgcagatggcgaatcatatttagat
ttttttgacaaaaacaaagaaaatcatgaagatccttatctcattttgtatattgaatta
ggattaagttttgactcagtagacaattttgcaagcttaataggatattcaaaagattgc
gaaactagatattatgcaatagtttataaatctatttatgattttggaattcaagttaat
gatacatattacaatttgtctgatttacataaaaattgacttgaatttacaaatgagtta
atactaaataataagttatcaatttcaaagcttgctattgataatgtatttattaattcg
ataaacaaactaattgaaatgcaaaaattatattatgcagaaaaagaagttccaactata
gcacttagttttattaaagaacaagaagactttatttttgaaaaattaataactataaaa
aataagataaataaaactattccgcaaatagaagatgatacattaactgctaaacaactt
gatgctttaaacattgcactaaatgaaccgataagcataatttcaggattccctggcact
ggcaaaacatatttaattagtaatatttatgagtcattaattgcccaaaaagtctataaa
aaaggtgaaatagaaattttgacccccactggtagagctgcaattaatattaaaaataag
agtaataatttgcctgcaaaaacgattcacaactatttaaaaattgataaagaagatgaa
gacgttgtttataacaatgattgtgacaaaacgaaagttgtaattattgacgagttttca
atggttaatttaaagattttttatcaacttttaagtcatttatccaagcttgaaaagctc
attattgttggagataaagatcagcttccatgtattggacctggcaatttaatgcacgac
ttatgtaattgagattttattcctaaaactcttttaattgaaaatcaaagagctgaaagt
gatgaaatttgcgaacactttttaagtattattgattcaaaagttaaagaagttgaaata
ggaagtacaaacacaattcaaatgaaagaaataaactcagttgcattattaaacgaatta
tcatacttatatcaaacttataatccagaatacaattctgaaaaaatggtaaccttgatt
ccacttcatgatggtcaagttggagccaaaacagttaataaatgattgcaaaaagaaaaa
ctaaataattacacatataagttgcctaaatttaaacaaagtaaagacaactatatccaa
tcttgagaaggtacaaaattctatttatttgacaatgttatccaattaataaatgattat
gaaaaaaatgtttttaatggcgagatcggaataataaaagaaataatagatgacaaaatt
gttagtgttgaatatccacaaggtggaaataaatttaaaacagttaattatgtaaaatca
gaaatagcaattaatttatctttagcatatgctttaactgttcataaatttcaaggttca
gaagcgccacatgttgtaattccggtttttaaagattattcaagaatgcttaataaaaaa
cttttatatacagcagtttcaagagctaaagaaaaattatttattttaggcgacttagct
ttatacgctaaaaaaacaaaaactgaagattatagtaaaataaaaacatatttatttgat
ttaattaaggaacaaaattaa

DBGET integrated database retrieval system